KEGG   Homo sapiens (human): 1528Help
Entry
1528              CDS       T01001                                 

Gene name
CYB5A, CYB5, MCB5
Definition
(RefSeq) cytochrome b5 type A
Organism
hsa  Homo sapiens (human)
Disease
H00235  
Methemoglobinemia
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P00167(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
18q22.3
AA seq 134 aa AA seqDB search
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA
VAVALMYRLYMAED
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagtcggacgaggccgtgaagtactacaccctagaggagattcagaagcac
aaccacagcaagagcacctggctgatcctgcaccacaaggtgtacgatttgaccaaattt
ctggaagagcatcctggtggggaagaagttttaagggaacaagctggaggtgacgctact
gagaactttgaggatgtcgggcactctacagatgccagggaaatgtccaaaacattcatc
attggggagctccatccagatgacagaccaaagttaaacaagcctccggaaactcttatc
actactattgattctagttccagttggtggaccaactgggtgatccctgccatctctgca
gtggccgtcgccttgatgtatcgcctatacatggcagaggactga

DBGET integrated database retrieval system