KEGG   Homo sapiens (human): 153Help
Entry
153               CDS       T01001                                 

Gene name
ADRB1, ADRB1R, B1AR, BETA1AR, RHR
Definition
adrenoceptor beta 1
Orthology
K04141  
adrenergic receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Endocytosis
Adrenergic signaling in cardiomyocytes
Gap junction
Salivary secretion
Dilated cardiomyopathy
Drug target
Epinephrine: 
Propafenone: 
Amiodarone: 
Dronedarone: 
Isoprenaline: 
Norepinephrine: 
Dobutamine: 
Prenalterol: 
Arbutamine: 
Ephedrine: 
Xamoterol: 
Buphenine: 
Alprenolol: 
Oxprenolol: 
Pindolol: 
Propranolol: 
Timolol: 
Sotalol: 
Nadolol: 
Mepindolol: 
Carteolol: 
Tertatolol: 
Bopindolol: 
Bupranolol: 
Penbutolol: 
Cloranolol: 
Practolol: 
Metoprolol: 
Atenolol: 
Acebutolol: 
Betaxolol: 
Bevantolol: 
Bisoprolol: 
Celiprolol: 
Esmolol: 
Epanolol: 
S-atenolol: 
Nebivolol: 
Talinolol: 
Labetalol: 
Carvedilol: 
Pseudoephedrine: 
Isoprenaline: 
Dipivefrine: 
Levobunolol: 
Metipranolol: 
Befunolol: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25.3
AA seq 477 aa AA seqDB search
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgggggtgctcgtcctgggcgcctccgagcccggtaacctgtcgtcggccgca
ccgctccccgacggcgcggccaccgcggcgcggctgctggtgcccgcgtcgccgcccgcc
tcgttgctgcctcccgccagcgaaagccccgagccgctgtctcagcagtggacagcgggc
atgggtctgctgatggcgctcatcgtgctgctcatcgtggcgggcaatgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctgtggacctcagtggacgtgctg
tgcgtgacggccagcatcgagaccctgtgtgtcattgccctggaccgctacctcgccatc
acctcgcccttccgctaccagagcctgctgacgcgcgcgcgggcgcggggcctcgtgtgc
accgtgtgggccatctcggccctggtgtccttcctgcccatcctcatgcactggtggcgg
gcggagagcgacgaggcgcgccgctgctacaacgaccccaagtgctgcgacttcgtcacc
aaccgggcctacgccatcgcctcgtccgtagtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgtttcctcggcggcccagcgcggccgccctcgccctcgccctcgcccgtc
cccgcgcccgcgccgccgcccggacccccgcgccccgccgccgccgccgccaccgccccg
ctggccaacgggcgtgcgggtaagcggcggccctcgcgcctcgtggccctgcgcgagcag
aaggcgctcaagacgctgggcatcatcatgggcgtcttcacgctctgctggctgcccttc
ttcctggccaacgtggtgaaggccttccaccgcgagctggtgcccgaccgcctcttcgtc
ttcttcaactggctgggctacgccaactcggccttcaaccccatcatctactgccgcagc
cccgacttccgcaaggccttccagggactgctctgctgcgcgcgcagggctgcccgccgg
cgccacgcgacccacggagaccggccgcgcgcctcgggctgtctggcccggcccggaccc
ccgccatcgcccggggccgcctcggacgacgacgacgacgatgtcgtcggggccacgccg
cccgcgcgcctgctggagccctgggccggctgcaacggcggggcggcggcggacagcgac
tcgagcctggacgagccgtgccgccccggcttcgcctcggaatccaaggtgtag

DBGET integrated database retrieval system