KEGG   Homo sapiens (human): 153Help
Entry
153               CDS       T01001                                 

Gene name
ADRB1, ADRB1R, B1AR, BETA1AR, RHR
Definition
adrenoceptor beta 1
Orthology
K04141  
adrenergic receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Endocytosis
Adrenergic signaling in cardiomyocytes
Gap junction
Salivary secretion
Dilated cardiomyopathy
Drug target
Epinephrine: 
Propafenone: 
Amiodarone: 
Dronedarone: 
Isoprenaline: 
Norepinephrine: 
Dobutamine: 
Prenalterol: 
Arbutamine: 
Ephedrine: 
Xamoterol: 
Buphenine: 
Alprenolol: 
Oxprenolol: 
Pindolol: 
Propranolol: 
Timolol: 
Sotalol: 
Nadolol: 
Mepindolol: 
Carteolol: 
Tertatolol: 
Bopindolol: 
Bupranolol: 
Penbutolol: 
Cloranolol: 
Practolol: 
Metoprolol: 
Atenolol: 
Acebutolol: 
Betaxolol: 
Bevantolol: 
Bisoprolol: 
Celiprolol: 
Esmolol: 
Epanolol: 
S-atenolol: 
Nebivolol: 
Talinolol: 
Labetalol: 
Carvedilol: 
Pseudoephedrine: 
Isoprenaline: 
Dipivefrine: 
Levobunolol: 
Metipranolol: 
Befunolol: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    153 (ADRB1)
   04024 cAMP signaling pathway
    153 (ADRB1)
   04022 cGMP - PKG signaling pathway
    153 (ADRB1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    153 (ADRB1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    153 (ADRB1)
  Cell communication
   04540 Gap junction
    153 (ADRB1)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    153 (ADRB1)
  Digestive system
   04970 Salivary secretion
    153 (ADRB1)
 Human Diseases
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    153 (ADRB1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    153 (ADRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25.3
AA seq 477 aa AA seqDB search
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgggggtgctcgtcctgggcgcctccgagcccggtaacctgtcgtcggccgca
ccgctccccgacggcgcggccaccgcggcgcggctgctggtgcccgcgtcgccgcccgcc
tcgttgctgcctcccgccagcgaaagccccgagccgctgtctcagcagtggacagcgggc
atgggtctgctgatggcgctcatcgtgctgctcatcgtggcgggcaatgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctgtggacctcagtggacgtgctg
tgcgtgacggccagcatcgagaccctgtgtgtcattgccctggaccgctacctcgccatc
acctcgcccttccgctaccagagcctgctgacgcgcgcgcgggcgcggggcctcgtgtgc
accgtgtgggccatctcggccctggtgtccttcctgcccatcctcatgcactggtggcgg
gcggagagcgacgaggcgcgccgctgctacaacgaccccaagtgctgcgacttcgtcacc
aaccgggcctacgccatcgcctcgtccgtagtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgtttcctcggcggcccagcgcggccgccctcgccctcgccctcgcccgtc
cccgcgcccgcgccgccgcccggacccccgcgccccgccgccgccgccgccaccgccccg
ctggccaacgggcgtgcgggtaagcggcggccctcgcgcctcgtggccctgcgcgagcag
aaggcgctcaagacgctgggcatcatcatgggcgtcttcacgctctgctggctgcccttc
ttcctggccaacgtggtgaaggccttccaccgcgagctggtgcccgaccgcctcttcgtc
ttcttcaactggctgggctacgccaactcggccttcaaccccatcatctactgccgcagc
cccgacttccgcaaggccttccagggactgctctgctgcgcgcgcagggctgcccgccgg
cgccacgcgacccacggagaccggccgcgcgcctcgggctgtctggcccggcccggaccc
ccgccatcgcccggggccgcctcggacgacgacgacgacgatgtcgtcggggccacgccg
cccgcgcgcctgctggagccctgggccggctgcaacggcggggcggcggcggacagcgac
tcgagcctggacgagccgtgccgccccggcttcgcctcggaatccaaggtgtag

DBGET integrated database retrieval system