KEGG   Homo sapiens (human): 153657Help
Entry
153657            CDS       T01001                                 

Gene name
TTC23L, MC25-1
Definition
(RefSeq) tetratricopeptide repeat domain 23 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_12 TPR_19 Cep57_CLD_2
Motif
Other DBs
NCBI-GeneID: 153657
NCBI-ProteinID: NP_653326
OMIM: 616344
HGNC: 26355
Ensembl: ENSG00000205838
Vega: OTTHUMG00000162020
Pharos: Q6PF05(Tdark)
UniProt: Q6PF05
Position
5p13.2
AA seq 361 aa AA seqDB search
MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEETKAKEKEKAI
DCMSHPKEKLAQSQKKVAQLIKEKMNTQANKELIRCVILSRIIFGDHHWKCARALANLAY
GYLTLRGLPVQAKKHATSAKNTLLTWKANTTSNKEKEEILEALVKLYYTLGVAWLLQNRG
REAYFNLQKAERNMKELKELYKGGVCELQVSENDLTLALGRASLAIHRLNLALAYFEKAI
GDVIAAKGDRTSDLISLYEEAAQIEQLRRNHNQAIQYLQQAHSVCVSLFTEVSPKTAEMS
ALLAKAYAMSGEAQHRDAVEIYFIRSINAYRATLGSEDFETLSTTEEFCKWLVQNGEKQD
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccagccccatccgtatcccaactgttagcaatgacatcgactgggatttctgc
ttccatatgtcacagcaaaccgagatcccagctcaccagcaaacagatgagttgtatccc
actggtgggtgtggagagagtgaagaggaaactaaagctaaagagaaggagaaggccata
gactgtatgtctcatcccaaagagaaattagcccaatcccagaagaaagtagctcagctg
attaaggaaaaaatgaatactcaagcaaacaaggagctgattcgatgtgtcatcctttct
cggattatttttggggaccatcactggaaatgtgcacgagctctggccaacctagcttat
ggctacttgacactgagaggcctcccagttcaggccaagaaacatgctacatcagccaag
aatacactgttgacctggaaggcaaatacgacctcaaataaggagaaagaggaaatcctg
gaagctctggtcaagctgtactacactctgggcgtggcctggctcctgcagaaccgtggc
agagaagcctatttcaacctgcagaaggcagagagaaacatgaaggagctgaaagaatta
tataaaggaggtgtttgtgaattacaagtctctgagaacgacctaacacttgctttgggc
agagcctccttggccatccacagactgaacctagctctggcatactttgaaaaggcaatt
ggcgatgttattgctgccaagggtgataggacgtcagatctgatcagcctgtacgaggaa
gctgctcagatagagcagctgaggaggaaccacaaccaggccatccagtacttgcagcag
gctcattctgtctgtgtttctttgttcactgaagtcagccccaaaactgcagaaatgagt
gcgttactggccaaagcttatgccatgtctggagaggcccagcacagggatgctgttgag
atatatttcataagaagtatcaatgcatatcgagcaacattgggctcagaggattttgaa
acactgagcaccactgaagaattttgcaaatggcttgtccaaaatggagaaaaacaggac
aagtag

DBGET integrated database retrieval system