KEGG   Homo sapiens (human): 154Help
Entry
154               CDS       T01001                                 

Gene name
ADRB2, ADRB2R, ADRBR, B2AR, BAR, BETA2AR
Definition
adrenoceptor beta 2, surface
Orthology
K04142  
adrenergic receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Endocytosis
Adrenergic signaling in cardiomyocytes
Salivary secretion
Disease
H00079  
Asthma
Drug target
Epinephrine: 
Isoprenaline: 
Norepinephrine: 
Dopexamine: 
Arbutamine: 
Ephedrine: 
Isoxsuprine: 
Buphenine: 
Alprenolol: 
Oxprenolol: 
Pindolol: 
Propranolol: 
Timolol: 
Sotalol: 
Nadolol: 
Mepindolol: 
Carteolol: 
Tertatolol: 
Bopindolol: 
Bupranolol: 
Penbutolol: 
Cloranolol: 
Labetalol: 
Carvedilol: 
Ritodrine: 
Fenoterol: 
Pseudoephedrine: 
Isoprenaline: 
Orciprenaline: 
Salbutamol: 
Terbutaline: 
Fenoterol: 
Rimiterol: 
Hexoprenaline: 
Isoetarine: 
Pirbuterol: 
Tretoquinol: 
Carbuterol: 
Tulobuterol: 
Salmeterol: 
Formoterol: 
Clenbuterol: 
Reproterol: 
Procaterol: 
Bitolterol: 
Indacaterol: 
Olodaterol: 
Methoxyphenamine: 
Bambuterol: 
Dipivefrine: 
Levobunolol: 
Metipranolol: 
Befunolol: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31-q32
AA seq 413 aa AA seqDB search
MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE
AINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF
HVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNT
GEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggggcaacccgggaacggcagcgccttcttgctggcacccaatagaagccatgcgccg
gaccacgacgtcacgcagcaaagggacgaggtgtgggtggtgggcatgggcatcgtcatg
tctctcatcgtcctggccatcgtgtttggcaatgtgctggtcatcacagccattgccaag
ttcgagcgtctgcagacggtcaccaactacttcatcacttcactggcctgtgctgatctg
gtcatgggcctggcagtggtgccctttggggccgcccatattcttatgaaaatgtggact
tttggcaacttctggtgcgagttttggacttccattgatgtgctgtgcgtcacggccagc
attgagaccctgtgcgtgatcgcagtggatcgctactttgccattacttcacctttcaag
taccagagcctgctgaccaagaataaggcccgggtgatcattctgatggtgtggattgtg
tcaggccttacctccttcttgcccattcagatgcactggtaccgggccacccaccaggaa
gccatcaactgctatgccaatgagacctgctgtgacttcttcacgaaccaagcctatgcc
attgcctcttccatcgtgtccttctacgttcccctggtgatcatggtcttcgtctactcc
agggtctttcaggaggccaaaaggcagctccagaagattgacaaatctgagggccgcttc
catgtccagaaccttagccaggtggagcaggatgggcggacggggcatggactccgcaga
tcttccaagttctgcttgaaggagcacaaagccctcaagacgttaggcatcatcatgggc
actttcaccctctgctggctgcccttcttcatcgttaacattgtgcatgtgatccaggat
aacctcatccgtaaggaagtttacatcctcctaaattggataggctatgtcaattctggt
ttcaatccccttatctactgccggagcccagatttcaggattgccttccaggagcttctg
tgcctgcgcaggtcttctttgaaggcctatgggaatggctactccagcaacggcaacaca
ggggagcagagtggatatcacgtggaacaggagaaagaaaataaactgctgtgtgaagac
ctcccaggcacggaagactttgtgggccatcaaggtactgtgcctagcgataacattgat
tcacaagggaggaattgtagtacaaatgactcactgctgtaa

DBGET integrated database retrieval system