KEGG   Homo sapiens (human): 154Help
Entry
154               CDS       T01001                                 

Gene name
ADRB2, ADRB2R, ADRBR, B2AR, BAR, BETA2AR
Definition
adrenoceptor beta 2, surface
Orthology
K04142  
adrenergic receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Endocytosis
Adrenergic signaling in cardiomyocytes
Salivary secretion
Disease
H00079  
Asthma
Drug target
Epinephrine: 
Isoprenaline: 
Norepinephrine: 
Dopexamine: 
Arbutamine: 
Ephedrine: 
Isoxsuprine: 
Buphenine: 
Alprenolol: 
Oxprenolol: 
Pindolol: 
Propranolol: 
Timolol: 
Sotalol: 
Nadolol: 
Mepindolol: 
Carteolol: 
Tertatolol: 
Bopindolol: 
Bupranolol: 
Penbutolol: 
Cloranolol: 
Labetalol: 
Carvedilol: 
Ritodrine: 
Fenoterol: 
Pseudoephedrine: 
Isoprenaline: 
Orciprenaline: 
Salbutamol: 
Terbutaline: 
Fenoterol: 
Rimiterol: 
Hexoprenaline: 
Isoetarine: 
Pirbuterol: 
Tretoquinol: 
Carbuterol: 
Tulobuterol: 
Salmeterol: 
Formoterol: 
Clenbuterol: 
Reproterol: 
Procaterol: 
Bitolterol: 
Indacaterol: 
Olodaterol: 
Methoxyphenamine: 
Bambuterol: 
Dipivefrine: 
Levobunolol: 
Metipranolol: 
Befunolol: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    154 (ADRB2)
   04022 cGMP - PKG signaling pathway
    154 (ADRB2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    154 (ADRB2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    154 (ADRB2)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    154 (ADRB2)
  Digestive system
   04970 Salivary secretion
    154 (ADRB2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    154 (ADRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31-q32
AA seq 413 aa AA seqDB search
MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE
AINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF
HVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNT
GEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggggcaacccgggaacggcagcgccttcttgctggcacccaatagaagccatgcgccg
gaccacgacgtcacgcagcaaagggacgaggtgtgggtggtgggcatgggcatcgtcatg
tctctcatcgtcctggccatcgtgtttggcaatgtgctggtcatcacagccattgccaag
ttcgagcgtctgcagacggtcaccaactacttcatcacttcactggcctgtgctgatctg
gtcatgggcctggcagtggtgccctttggggccgcccatattcttatgaaaatgtggact
tttggcaacttctggtgcgagttttggacttccattgatgtgctgtgcgtcacggccagc
attgagaccctgtgcgtgatcgcagtggatcgctactttgccattacttcacctttcaag
taccagagcctgctgaccaagaataaggcccgggtgatcattctgatggtgtggattgtg
tcaggccttacctccttcttgcccattcagatgcactggtaccgggccacccaccaggaa
gccatcaactgctatgccaatgagacctgctgtgacttcttcacgaaccaagcctatgcc
attgcctcttccatcgtgtccttctacgttcccctggtgatcatggtcttcgtctactcc
agggtctttcaggaggccaaaaggcagctccagaagattgacaaatctgagggccgcttc
catgtccagaaccttagccaggtggagcaggatgggcggacggggcatggactccgcaga
tcttccaagttctgcttgaaggagcacaaagccctcaagacgttaggcatcatcatgggc
actttcaccctctgctggctgcccttcttcatcgttaacattgtgcatgtgatccaggat
aacctcatccgtaaggaagtttacatcctcctaaattggataggctatgtcaattctggt
ttcaatccccttatctactgccggagcccagatttcaggattgccttccaggagcttctg
tgcctgcgcaggtcttctttgaaggcctatgggaatggctactccagcaacggcaacaca
ggggagcagagtggatatcacgtggaacaggagaaagaaaataaactgctgtgtgaagac
ctcccaggcacggaagactttgtgggccatcaaggtactgtgcctagcgataacattgat
tcacaagggaggaattgtagtacaaatgactcactgctgtaa

DBGET integrated database retrieval system