KEGG   Homo sapiens (human): 154141Help
Entry
154141            CDS       T01001                                 

Gene name
MBOAT1, 1, LPEAT1, LPLAT, LPLAT_1, LPSAT, OACT1, dJ434O11.1
Definition
membrane bound O-acyltransferase domain containing 1 (EC:2.3.1.n6)
Orthology
K13517  
lysophospholipid acyltransferase 1/2 [EC:2.3.1.51 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    154141 (MBOAT1)
   00564 Glycerophospholipid metabolism
    154141 (MBOAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     154141 (MBOAT1)
    2.3.1.-  
     154141 (MBOAT1)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   154141 (MBOAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Position
6p22.3
AA seq 495 aa AA seqDB search
MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTS
SDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTI
CHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKP
SFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGA
VIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAW
TLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCV
CYQRVPWYPTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKA
VYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQ
RRPQTLNSINKRKTD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagagccgcagccgtccagcctttcctaccgcaccacgggctccacctacctg
cacccgctcagcgagctcctgggcatcccgctggaccaggtgaattttgtggtatgccag
cttgttgctctgtttgctgctttctggtttcgcatctacttacgtcctggtacaaccagc
tctgatgtccggcatgcggttgccaccatttttggcatctattttgtcatcttttgtttc
ggctggtactctgtgcatctttttgtgctggtgttaatgtgctatgcaatcatggtcact
gctagtgtatccaatattcacagatattccttttttgtagcaatgggatatcttacaata
tgccacatcagccgaatatacatcttccactatggaattctcactacggatttttctggg
cctctgatgattgtcactcagaagatcacaaccttggcattccaggttcatgatggatta
ggtcgaagagctgaagacctttctgctgaacaacatcgacttgctatcaaagtgaaaccc
tcttttttggaatacttaagttaccttctcaatttcatgagtgtcatagctggtccttgt
aacaatttcaaggactacatagccttcattgaggggaagcatatacacatgaagttgctg
gaggtgaactggaagcgaaaaggtttccacagcttgccagaaccttctcccacaggagct
gtgatacacaagttgggcatcaccttggtgtctctccttttgtttttgacgctaacgaag
acctttcctgtcacctgccttgtggatgactggtttgtccataaagcaagctttccggct
cgactctgctacttatatgttgtcatgcaagcctcaaagcccaagtattactttgcatgg
acattagctgatgcagtgaataacgcagctggctttgggttcagcggagtggataagaat
gggaatttctgttgggatctgctttcgaacctaaacatctggaaaattgagactgccaca
agtttcaaaatgtacttggaaaactggaatattcagacagctacttggctaaagtgtgtg
tgctatcagcgggttccatggtaccccacggtgctaaccttcatcctgtctgctttgtgg
catggtgtctaccctggatactattttaccttcttaactggaattcttgtcacattagca
gctagagcggtcaggaacaactacagacattacttcctttcttcaagagctctcaaggct
gtgtatgatgcaggcacctgggccgtcactcagctggctgtctcttacacggtagcaccc
tttgtgatgttggcagttgaaccgaccatcagcttatacaagtccatgtacttttatttg
cacatcataagtctcctgataatactatttctgccaatgaaaccacaagctcatacgcaa
aggcggcctcagactctgaactctattaataagagaaaaacagattga

DBGET integrated database retrieval system