KEGG   Homo sapiens (human): 154664Help
Entry
154664            CDS       T01001                                 

Gene name
ABCA13
Definition
ATP-binding cassette, sub-family A (ABC1), member 13
Orthology
K05647  
ATP binding cassette, subfamily A (ABC1), member 13
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsa02010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p12.3
AA seq 5058 aa AA seqDB search
MGHAGCQFKALLWKNWLCRLRNPVLFLAEFFWPCILFVILTVLRFQEPPRYRDICYLQPR
DLPSCGVIPFVQSLLCNTGSRCRNFSYEGSMEHHFRLSRFQTAADPKKVNNLAFLKEIQD
LAEEIHGMMDKAKNLKRLWVERSNTPDSSYGSSFFTMDLNKTEEVILKLESLHQQPHIWD
FLLLLPRLHTSHDHVEDGMDVAVNLLQTILNSLISLEDLDWLPLNQTFSQVSELVLNVTI
STLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEI
PTDTSLEKMVCSVLSSTSEDEAEKWGHVGGCHPKWSEAKNYLVHAVSWLRVYQQVFVQWQ
QGSLLQKTLTGMGHSLEALRNQFEEESKPWKVVEALHTALLLLNDSLSADGPKDNHTFPK
ILQHLWKLQSLLQNLPQWPALKRFLQLDGALRNAIAQNLHFVQEVLICLETSANDFKWFE
LNQLKLEKDVFFWELKQMLAKNAVCPNGRFSEKEVFLPPGNSSIWGGLQGLLCYCNSSET
SVLNKLLGSVEDADRILQEVITWHKNMSVLIPEEYLDWQELEMQLSEASLSCTRLFLLLG
ADPSPENDVFSSDCKHQLVSTVIFHTLEKTQFFLEQAYYWKAFKKFIRKTCEVAQYVNMQ
ESFQNRLLAFPEESPCFEENMDWKMISDNYFQFLNNLLKSPTASISRALNFTKHLLMMEK
KLHTLEDEQMNFLLSFVEFFEKLLLPNLFDSSIVPSFHSLPSLTEDILNISSLWTNHLKS
LKRDPSATDAQKLLEFGNEVIWKMQTLGSHWIRKEPKNLLRFIELILFEINPKLLELWAY
GISKGKRAKLENFFTLLNFSVPENEILSTSFNFSQLFHSDWPKSPAMNIDFVRLSEAIIT
SLHEFGFLEQEQISEALNTVYAIRNASDLFSALSEPQKQEVDKILTHIHLNVFQDKDSAL
LLQIYSSFYRYIYELLNIQSRGSSLTFLTQISKHILDIIKQFNFQNISKAFAFLFKTAEV
LGGISNVSYCQQLLSIFNFLELQAQSFMSTEGQELEVIHTTLTGLKQLLIIDEDFRISLF
QYMSQFFNSSVEDLLDNKCLISDNKHISSVNYSTSEESSFVFPLAQIFSNLSANVSVFNK
FMSIHCTVSWLQMWTEIWETISQLFKFDMNVFTSLHHGFTQLLDELEDDVKVSKSCQGIL
PTHNVARLILNLFKNVTQANDFHNWEDFLDLRDFLVALGNALVSVKKLNLEQVEKSLFTM
EAALHQLKTFPFNESTSREFLNSLLEVFIEFSSTSEYIVRNLDSINDFLSNNLTNYGEKF
ENIITELREAIVFLRNVSHDRDLFSCADIFQNVTECILEDGFLYVNTSQRMLRILDTLNS
TFSSENTISSLKGCIVWLDVINHLYLLSNSSFSQGHLQNILGNFRDIENKMNSILKIVTW
VLNIKKPLCSSNGSHINCVNIYLKDVTDFLNIVLTTVFEKEKKPKFEILLALLNDSTKQV
RMSINNLTTDFDFASQSNWRYFTELILRPIEMSDEIPNQFQNIWLHLITLGKEFQKLVKG
IYFNILENNSSSKTENLLNIFATSPKEKDVNSVGNSIYHLASYLAFSLSHDLQNSPKIII
SPEIMKATGLGIQLIRDVFNSLMPVVHHTSPQNAGYMQALKKVTSVMRTLKKADIDLLVD
QLEQVSVNLMDFFKNISSVGTGNLVVNLLVGLMEKFADSSHSWNVNHLLQLSRLFPKDVV
DAVIDVYYVLPHAVRLLQGVPGKNITEGLKDVYSFTLLHGITISNITKEDFAIVIKILLD
TIELVSDKPDIISEALACFPVVWCWNHTNSGFRQNSKIDPCNVHGLMSSSFYGKVASILD
HFHLSPQGEDSPCSNESSRMEITRKVVCIIHELVDWNSILLELSEVFHVNISLVKTVQKF
WHKILPFVPPSINQTRDSISELCPSGSIKQVALQIIEKLKNVNFTKVTSGENILDKLSSL
NKILNINEDTETSVQNIISSNLERTVQLISEDWSLEKSTHNLLSLFMMLQNANVTGSSLE
ALSSFIEKSETPYNFEELWPKFQQIMKDLTQDFRIRHLLSEMNKGIKSINSMALQKITLQ
FAHFLEILDSPSLKTLEIIEDFLLVTKNWLQEYANEDYSRMIETLFIPVTNESSTEDIAL
LAKAIATFWGSLKNISRAGNFDVAFLTHLLNQEQLTNFSVVQLLFENILINLINNLAGNS
QEAAWNLNDTDLQIMNFINLILNHMQSETSRKTVLSLRSIVDFTEQFLKTFFSLFLKEDS
ENKISLLLKYFHKDVIAEMSFVPKDKILEILKLDQFLTLMIQDRLMNIFSSLKETIYHLM
KSSFILDNGEFYFDTHQGLKFMQDLFNALLRETSMKNKTENNIDFFTVVSQLFFHVNKSE
DLFKLNQDLGSALHLVRECSTEMARLLDTILHSPNKDFYALYPTLQEVILANLTDLLFFI
NNSFPLRNRATLEITKRLVGAISRASEESHVLKPLLEMSGTLVMLLNDSADLRDLATSMD
SIVKLLKLVKKVSGKMSTVFKTHFISNTKDSVKFFDTLYSIMQQSVQNLVKEIATLKKID
HFTFEKINDLLVPFLDLAFEMIGVEPYISSNSDIFSMSPSILSYMNQSKDFSDILEEIAE
FLTSVKMNLEDMRSLAVAFNNETQTFSMDSVNLREEILGCLVPINNITNQMDFLYPNPIS
THSGPQDIKWEIIHEVIPFLDKILSQNSTEIGSFLKMVICLTLEALWKNLKKDNWNVSNV
LMTFTQHPNNLLKTIETVLEASSGIKSDYEGDLNKSLYFDTPLSQNITHHQLEKAIHNVL
SRIALWRKGLLFNNSEWITSTRTLFQPLFEIFIKATTGKNVTSEKEERTKKEMIDFPYSF
KPFFCLEKYLGGLFVLTKYWQQIPLTDQSVVEICEVFQQTVKPSEAMEMLQKVKMMVVRV
LTIVAENPSWTKDILCATLSCKQNGIRHLILSAIQGVTLAQDHFQEIEKIWSSPNQLNCE
SLSKNLSSTLESFKSSLENATGQDCTSQPRLETVQQHLYMLAKSLEETWSSGNPIMTFLS
NFTVTEDVKIKDLMKNITKLTEELRSSIQISNETIHSILEANISHSKVLFSALTVALSGK
CDQEILHLLLTFPKGEKSWIAAEELCSLPGSKVYSLIVLLSRNLDVRAFIYKTLMPSEAN
GLLNSLLDIVSSLSALLAKAQHVFEYLPEFLHTFKITALLETLDFQQVSQNVQARSSAFG
SFQFVMKMVCKDQASFLSDSNMFINLPRVKELLEDDKEKFNIPEDSTPFCLKLYQEILQL
PNGALVWTFLKPILHGKILYTPNTPEINKVIQKANYTFYIVDKLKTLSETLLEMSSLFQR
SGSGQMFNQLQEALRNKFVRNFVENQLHIDVDKLTEKLQTYGGLLDEMFNHAGAGRFRFL
GSILVNLSSCVALNRFQALQSVDILETKAHELLQQNSFLASIIFSNSLFDKNFRSESVKL
PPHVSYTIRTNVLYSVRTDVVKNPSWKFHPQNLPADGFKYNYVFAPLQDMIERAIILVQT
GQEALEPAAQTQAAPYPCHTSDLFLNNVGFFFPLIMMLTWMVSVASMVRKLVYEQEIQIE
EYMRMMGVHPVIHFLAWFLENMAVLTISSATLAIVLKTSGIFAHSNTFIVFLFLLDFGMS
VVMLSYLLSAFFSQANTAALCTSLVYMISFLPYIVLLVLHNQLSFVNQTFLCLLSTTAFG
QGVFFITFLEGQETGIQWNNMYQALEQGGMTFGWVCWMILFDSSLYFLCGWYLSNLIPGT
FGLRKPWYFPFTASYWKSVGFLVEKRQYFLSSSLFFFNENFDNKGSSLQNREGELEGSAP
GVTLVSVTKEYEGHKAVVQDLSLTFYRDQITALLGTNGAGKTTIISMLTGLHPPTSGTII
INGKNLQTDLSRVRMELGVCPQQDILLDNLTVREHLLLFASIKAPQWTKKELHQQVNQTL
QDVDLTQHQHKQTRALSGGLKRKLSLGIAFMGMSRTVVLDEPTSGVDPCSRHSLWDILLK
YREGRTIIFTTHHLDEAEALSDRVAVLQHGRLRCCGPPFCLKEAYGQGLRLTLTRQPSVL
EAHDLKDMACVTSLIKIYIPQAFLKDSSGSELTYTIPKDTDKACLKGLFQALDENLHQLH
LTGYGISDTTLEEVFLMLLQDSNKKSHIALGTESELQNHRPTGHLSGYCGSLARPATVQG
VQLLRAQVAAILARRLRRTLRAGKSTLADLLLPVLFVALAMGLFMVRPLATEYPPLRLTP
GHYQRAETYFFSSGGDNLDLTRVLLRKFRDQDLPCADLNPRQKNSSCWRTDPFSHPEFQD
SCGCLKCPNRSASAPYLTNHLGHTLLNLSGFNMEEYLLAPSEKPRLGGWSFGLKIPSEAG
GANGNISKPPTLAKVWYNQKGFHSLPSYLNHLNNLILWQHLPPTVDWRQYGITLYSHPYG
GALLNKDKILESIRQCGVALCIVLGFSILSASIGSSVVRDRVIGAKRLQHISGLGYRMYW
FTNFLYDMLFYLVSVCLCVAVIVAFQLTAFTFRKNLAATALLLSLFGYATLPWMYLMSRI
FSSSDVAFISYVSLNFIFGLCTMLITIMPRLLAIISKAKNLQNIYDVLKWVFTIFPQFCL
GQGLVELCYNQIKYDLTHNFGIDSYVSPFEMNFLGWIFVQLASQGTVLLLLRVLLHWDLL
RWPRGHSTLQGTVKSSKDTDVEKEEKRVFEGRTNGDILVLYNLSKHYRRFFQNIIAVQDI
SLGIPKGECFGLLGVNGAGKSTTFKMLNGEVSLTSGHAIIRTPMGDAVDLSSAGTAGVLI
GYCPQQDALDELLTGWEHLYYYCSLRGIPRQCIPEVAGDLIRRLHLEAHADKPVATYSGG
TKRKLSTALALVGKPDILLLDEPSSGMDPCSKRYLWQTIMKEVREGCAAVLTSHSMEECE
ALCTRLAIMVNGSFKCLGSPQHIKNRFGDGYTVKVWLCKEANQHCTVSDHLKLYFPGIQF
KGQHLNLLEYHVPKRWGCLADLFKVIENNKTFLNIKHYSINQTTLEQVFINFASEQQQTL
QSTLDPSTDSHHTHHLPI
NT seq 15177 nt NT seq  +upstreamnt  +downstreamnt
atggggcatgccgggtgccagttcaaagccctgctgtggaagaattggctctgcagactc
aggaacccggtccttttccttgctgaattcttctggccttgtatcctgtttgtaattctg
acagttcttcgttttcaagaacctcccagatacagagacatttgttatttgcagccccga
gatctacccagctgtggtgttatcccctttgttcaaagccttctttgtaacactggatca
aggtgtaggaacttcagctatgaagggtcaatggagcatcattttcgtttgtctaggttc
caaactgcagctgaccccaagaaagtcaacaacctggcctttttaaaagagatacaagac
ctggcagaggaaattcatggaatgatggacaaggcaaaaaacttaaaaagactttgggta
gaacgatccaacactccagattcttcttatggttccagtttttttacaatggatctcaat
aagaccgaggaggtaatattgaaactggaaagcctccatcagcagcctcatatctgggat
tttctacttttactgccgagactacacacaagccatgatcatgtggaagatggcatggat
gttgcagtgaaccttctccagaccattttgaattccttaatatccctagaagatttagat
tggcttccactcaaccaaactttttcccaggtttctgaacttgtactgaatgtgaccatt
tcgacactgacatttctgcagcaacatggagtagcagtcaccgagccagtttaccacctg
tccatgcagaatatagtgtgggatccacagaaagtccagtatgatctcaaatcccagttt
ggctttgatgatcttcacacggaacagatcctgaactcttcagctgaactgaaggagatt
cccacagacacttccttggagaagatggtgtgttcagtcttgtctagcacatcagaggat
gaagctgagaaatggggccacgttggaggctgccaccctaagtggtcagaagccaaaaac
tatcttgtccatgcagtcagctggctgcgagtctaccaacaggtgtttgttcagtggcaa
cagggtagcctgcttcagaagacactcacaggcatgggccatagtctggaggctctcagg
aatcagtttgaagaagagagcaagccctggaaggtggtggaagctctgcacactgcactg
ctcctgctgaatgacagcttgtcagcagatggcccaaaagataatcatacatttccaaag
atattacagcatctgtggaaattgcaaagcttgctgcaaaacctgccccagtggccggca
ctgaagagatttcttcagcttgatggagctctcagaaatgcgatagctcagaatttacat
tttgtccaagaagtcctcatttgcctggagacatcagctaatgattttaaatggtttgaa
cttaaccaattgaaactggaaaaggatgtgttcttttgggagctgaaacagatgttggcg
aagaatgctgtctgcccgaatggtcgtttctctgagaaggaggtctttttgccgcctgga
aactccagcatatggggtggtctccagggactgttgtgctattgtaactcctctgagacg
agtgttttaaacaagctacttggttcagtagaggatgctgatcgtattttgcaagaggtc
attacttggcacaaaaatatgtcagttttaatacctgaagaatatttggactggcaggaa
cttgagatgcagctgtcagaagcaagcctttcctgtactcggctcttcctgctgctggga
gctgatccctctcctgagaatgatgtcttttctagtgactgtaagcaccagcttgtctcc
acagtgatatttcatacacttgaaaaaacacaatttttcctggaacaagcatattattgg
aaagccttcaaaaagtttatcaggaagacttgcgaagtggcccaatatgtaaatatgcaa
gagagtttccagaacagactattggcttttcctgaggaatctccttgttttgaagaaaac
atggattggaaaatgatcagtgataattattttcaatttttgaataacttactcaagtct
ccaacagcttccatatccagggctttaaatttcacaaagcaccttctaatgatggaaaag
aagttgcacacccttgaggatgaacaaatgaactttcttttatcatttgtggaatttttt
gagaaattattgttgcctaatctttttgactcctccattgttcccagtttccacagcctc
ccatctctcacagaggatattctgaatataagttctctgtggacaaatcatttaaaaagt
ttaaagagagacccatctgccactgatgctcagaaactcttggaatttggcaacgaagtg
atttggaaaatgcagactctcggaagtcactggataaggaaggaaccaaaaaatcttttg
agattcatagaattaatactttttgaaattaatcccaaattactagaattatgggcctat
ggcatttcaaaaggaaaaagagctaaattggaaaacttctttacacttttaaatttttct
gttccagaaaatgagattctgagtacaagttttaacttttcccagttgttccattcagat
tggcctaaatcaccagctatgaacatagattttgtacgtttaagtgaggctataataact
agtctccatgaatttggatttttggagcaggaacagatctcagaagctctgaacacagtc
tacgctatcaggaatgcatctgatcttttctcagccctttctgaaccacaaaaacaagaa
gttgataaaattttgactcacatacacctaaatgtcttccaggacaaggattcagcttta
cttctgcaaatttattcttcattttaccgatatatttatgaattattgaatattcagagt
agaggctcttcgttgactttccttacacaaatctcaaaacacattttggatatcataaaa
caatttaatttccaaaacatcagtaaagcatttgcatttttatttaagacagcagaggtt
cttgggggaatttctaatgtatcttactgtcagcaattgctttcaatttttaactttttg
gagcttcaggcccaatccttcatgtctacagagggccaagaactggaagtgatccacact
actttgacaggcctcaaacagctgctcataattgatgaagattttcgtatttctttattt
caatatatgagccaattcttcaacagttcagtagaagacctattggataataaatgcttg
atttcggacaataaacacatttcttccgtaaattattcaacaagtgaggagtcttcattt
gtttttccattggcacaaattttttcaaacctctcagcaaatgtcagtgtgttcaacaag
tttatgtccattcactgtaccgtttcatggcttcaaatgtggactgaaatctgggaaacc
atatctcaattatttaagtttgacatgaatgttttcacatctcttcatcatggtttcact
cagcttttggatgaattggaagatgatgtgaaagtctctaaaagctgccagggtatactt
cccacccataatgttgctagactcatattaaatttgtttaaaaatgtaactcaagccaat
gacttccataattgggaggacttcctggatctcagggattttttggtagctttaggtaat
gcattagtttcagtaaaaaaacttaacttggagcaagtggagaaatcccttttcaccatg
gaagctgccctgcatcagttgaagacatttccattcaacgaaagtacaagcagagagttt
ttaaattctctgcttgaagttttcattgagtttagcagtacctcagaatatatagtcaga
aatctagattcaataaatgactttctttcaaataatctcacaaattatggagaaaaattt
gaaaatatcatcactgagctaagagaagcaatagtatttcttagaaatgtatcacatgat
cgagatttgttttcctgtgctgatattttccaaaatgttactgagtgtattttagaagat
ggctttttatatgtaaatacctcacagaggatgttacgtattctagacacgttaaattcc
acattttcctctgagaacacaattagcagtctgaaaggatgcattgtatggttagatgtc
ataaaccatttgtatttgttgtctaactccagtttttcacaaggtcatcttcaaaatatt
ttggggaatttcagagatatagaaaacaaaatgaactctatattaaaaattgtaacttgg
gtgttaaatataaaaaaacctctttgttcatcaaatggctcacatataaattgtgtcaat
atttacttgaaagatgtaactgactttctaaatattgtacttactacagtctttgaaaaa
gagaagaaacctaaatttgagattttattagctcttttaaatgattccacaaagcaagta
aggatgagtatcaacaacttaacaacagactttgattttgcatctcagtccaattggaga
tattttactgaattaattctaagaccaatagaaatgtcagatgaaattcctaatcagttt
caaaatatttggcttcatttaataacactggggaaggaatttcagaagcttgtaaaaggt
atttactttaacatcctggaaaataattcctcttctaaaactgaaaacttgttaaacata
tttgccaccagtccaaaagaaaaggatgtaaacagtgtaggcaattccatttatcactta
gctagttaccttgccttcagcttatctcatgacctccaaaattcaccaaaaataataatt
tcacctgaaataatgaaagctacaggtcttggtattcaactgataagggatgtgttcaac
tccttaatgcctgtagttcatcacactagtccacaaaatgcaggttatatgcaagctttg
aagaaggtaacttctgtcatgcgtacccttaagaaggcagacatagaccttttagtggat
cagcttgaacaagttagtgtaaacctaatggatttctttaagaatatcagtagtgtggga
actggcaatttagtggtcaatttgcttgttggcttgatggaaaaatttgcagacagctca
cattcttggaatgttaatcatctgctgcagctctcacgcctgtttcctaaagatgttgtg
gatgctgtgatagatgtgtactatgtgcttcctcatgctgtaaggctcctgcagggagta
cctggtaaaaacatcactgaaggcctcaaggatgtctacagcttcacactccttcatggc
ataaccatttcaaatatcaccaaggaagacttcgcaattgtgataaaaattcttttggat
acaattgaattagtatcagataagccagatattatttcagaggctttagcttgttttcct
gtggtttggtgctggaatcacacaaattctggatttcggcagaattcaaagatagacccc
tgcaatgtccatgggctcatgtcttcttccttttatggcaaagtggccagtatacttgat
catttccacctgtctccccaaggtgaagattcaccatgttcaaatgaaagctcccgaatg
gaaataactaggaaagtggtctgcataattcatgaattagtggactggaattctattctt
ctggagctctctgaagtcttccatgttaacatttctcttgtgaaaactgtgcagaaattt
tggcataagatattaccgtttgtcccaccttcaataaatcaaactagggatagcatctct
gaactctgtcctagtggttccataaagcaagttgctttgcaaatcatagaaaaacttaaa
aatgtcaactttacaaaagttacatcaggtgaaaatattcttgacaaactaagtagttta
aacaagatccttaacattaatgaagacacagagacatctgttcaaaatattatttcctca
aatttggaaaggacagtacaattgatttctgaagactggagcctagaaaaaagtacgcat
aatctactctctttattcatgatgctccagaatgcaaatgtcacaggtagcagtttagaa
gcattatcaagttttattgaaaaaagtgaaacaccttacaactttgaagaactatggccc
aagtttcaacaaatcatgaaagacctaacccaagattttagaatcagacacctgctttct
gaaatgaacaaaggaatcaaaagtataaattcaatggctcttcaaaagataactttgcag
tttgcccatttcctggaaatcctggattcaccgtcattgaagacattagaaattattgaa
gattttctattggtcacaaaaaactggcttcaggaatatgcaaatgaggattactccaga
atgatagaaacattattcattcctgtgaccaatgagagttcaactgaagatatagctttg
ttagccaaagctattgctactttttggggctctttaaaaaatatatctagagcaggcaat
tttgatgttgcctttcttacccatctgctaaatcaagaacagctgactaatttctcagtt
gttcagctgctttttgaaaacatcctaattaatttgatcaataacttagctgggaattct
caggaagcagcttggaacttaaatgatactgaccttcaaataatgaatttcattaacctt
atcttgaaccatatgcagtcagaaactagtaggaaaacagttctctctctgagaagcata
gtagatttcacagaacagtttttgaaaacattcttctccctttttctaaaggaagattct
gagaacaaaatatctcttctgctgaaatatttccacaaagatgttattgcagagatgagt
tttgtcccaaaagataaaattctagaaattctgaaactggatcaatttcttaccctgatg
atacaagacagattgatgaacattttttcaagtttaaaggagactatatatcacctaatg
aaaagttcatttatattagacaatggagaattttattttgatactcatcaaggactgaag
ttcatgcaagatttatttaatgcccttctcagggaaacttcaatgaaaaataagactgaa
aataatatagactttttcacagtggtgagtcagttgtttttccatgtgaataagtctgag
gacctcttcaaactcaatcaagatcttgggtcagctcttcaccttgtaagagaatgttca
acagagatggcaagacttctggatacaattttacactctcctaataaggacttctatgct
ttgtatcctaccctccaagaagttatacttgctaatctaacggatttgcttttctttata
aataattcattccctctaagaaacagagcaacattagaaattactaagagattagttggt
gctatttcaagagcaagtgaagaaagtcacgtcctgaaacccctcttagaaatgtctggg
actctggtcatgctgttgaatgacagtgctgacctgagagatcttgccacatcaatggac
tccattgtgaaacttcttaagctggtcaagaaagtttcggggaagatgtccacagttttt
aaaactcattttatctccaataccaaggacagtgtgaaattctttgacactctgtattcc
atcatgcaacaaagtgttcaaaatcttgtgaaagaaatagctactttaaaaaaaatagat
catttcacatttgaaaagataaatgatttgttggtgccatttcttgacttggcctttgaa
atgattggggtagaaccttatatatcatcaaactctgatattttcagtatgtcacctagc
atactctcatatatgaaccaatctaaggacttttctgatattttggaagaaattgctgaa
tttttaacatctgtgaaaatgaacttggaagatatgaggagtcttgcggtagcatttaac
aatgagactcaaacattttctatggattctgtcaacttacgggaagaaattctgggttgc
ttagttcctataaataacatcaccaaccaaatggacttcttataccctaatccaatttcc
actcatagtggccctcaagatataaaatgggaaataattcatgaagtgatcccttttttg
gataaaatattatcacaaaacagcacagaaataggatctttcttgaaaatggtgatctgt
ctcaccttagaagctctttggaaaaacttaaagaaagataattggaatgtttctaatgtg
ttgatgacatttactcagcatccaaataaccttttgaaaaccatagaaacagttttagag
gcctccagtggaattaaaagtgactatgaaggtgatttgaataaaagtttatattttgac
acacctttgagtcagaatataactcatcatcaacttgaaaaagcaatccataatgtttta
agtagaatagctctctggaggaaaggacttctgtttaacaactctgaatggataacttcc
acaagaactttgtttcagccactttttgagattttcattaaagcaaccaccggaaagaat
gtcacatcagaaaaagaagagagaaccaagaaagagatgattgactttccttatagtttc
aaaccatttttctgtttggagaaatacctgggaggattatttgtattgactaaatactgg
caacaaatcccactaacagatcaaagtgttgttgagatttgtgaagttttccagcagact
gtgaagccctcagaagccatggagatgctgcagaaagtgaagatgatggtcgtacgtgtg
ctcaccatcgttgcagaaaacccttcctggaccaaggacattttgtgtgctactctgagt
tgcaagcaaaatgggataaggcatctcattttatctgctatacaaggggtcactttggcg
caggaccacttccaggaaattgaaaagatatggtcctcgccgaatcagctaaattgtgaa
agtcttagcaagaatctttctagcaccttggagagcttcaagagcagcttggaaaatgcc
actggccaggactgcacaagccagccgaggctggagacggtgcagcagcacttgtacatg
ttggccaaaagcctcgaggaaacttggtcatcagggaatcccatcatgacttttctcagc
aatttcacagtaactgaggatgtaaaaataaaagatttgatgaagaatatcaccaagttg
actgaggagcttcgctcttccatccaaatctcgaatgagactatccatagcattctagaa
gcaaatatttcccactccaaggttctcttcagtgccctcaccgtagctctgtctggaaag
tgtgatcaggaaatccttcatctcctgctgacatttcccaaaggggaaaaatcttggatc
gcagcggaggaactctgtagcctgccagggtcaaaagtgtattctctgattgtgttgctg
agtcgaaacttggatgtgcgagctttcatttacaagactctgatgccttctgaagcaaat
ggcttgctcaactccttgctggatatagtttccagcctcagcgccttgcttgccaaagcc
cagcacgtctttgagtatcttcctgagtttcttcacacatttaaaatcactgccttgcta
gaaaccctggactttcaacaggtttcacaaaatgtccaggccagaagttcagcttttggt
tctttccagtttgtgatgaagatggtttgcaaggaccaagcatcattccttagcgattct
aatatgtttattaatttgcccagagttaaggaactcttggaagatgacaaagaaaaattc
aacattcctgaagattcaacaccgttttgcttgaagctttatcaggaaattctacaattg
ccaaatggtgctttggtgtggaccttcctaaaacccatattgcatggaaaaatactatac
acaccaaacactccagaaattaacaaggtcattcaaaaggctaattacaccttttatatt
gtggacaaactaaaaactttatcagaaacactgctggaaatgtccagccttttccagaga
agtggaagtggccagatgttcaaccagctgcaggaggccctgagaaacaaatttgtaaga
aactttgtagaaaaccagttgcacattgatgtagacaaacttactgaaaaactccagaca
tacggagggctgctggatgagatgtttaaccatgcaggcgctggacgcttccgtttcttg
ggcagcatcttggtcaatctctcttcctgcgtggcactgaaccgtttccaggctctgcag
tctgtcgacatcctggagactaaagcacatgaactcttgcagcagaacagcttcttggcc
agtatcattttcagcaattccttattcgacaagaacttcagatcagagtctgtcaaactg
ccaccccatgtctcatacacaatccggaccaatgtgttatacagcgtgcgaacagatgtg
gtaaaaaacccttcttggaagttccaccctcagaatctaccagctgatgggttcaaatat
aactacgtctttgccccactgcaagacatgatcgaaagagccatcattttggtgcagact
gggcaggaagccctggaaccagcagcacagactcaggcggccccttacccctgccatacc
agcgacctattcctgaacaacgttggtttcttttttccactgataatgatgctgacgtgg
atggtgtctgtggccagcatggtcagaaagttggtgtatgagcaggagatacagatagaa
gagtatatgcggatgatgggagtgcatccagtgatccatttcctggcctggttcctggag
aacatggctgtgttgaccataagcagtgctactctggccatcgttctgaaaacaagtggc
atctttgcacacagcaatacctttattgttttcctctttctcttggattttgggatgtca
gtcgtcatgctgagctacctcttgagtgcatttttcagccaagctaatacagcggccctt
tgtaccagcctggtgtacatgatcagctttctgccctacatagttctattggttctacat
aaccaattaagttttgttaatcagacatttctgtgccttctttcgacaaccgcctttgga
caaggggtattttttattacattcctggaaggacaagagacagggattcaatggaataat
atgtaccaggctctggaacaagggggcatgacatttggctgggtttgctggatgattctt
tttgattcaagcctttattttttgtgtggatggtacttgagcaacttgattcctggaaca
tttggtttacggaaaccatggtatttcccctttactgcctcatattggaagagtgtgggt
ttcttggtggagaaaaggcaatactttctaagttctagtctgttcttcttcaatgagaac
tttgacaataaagggtcatcactgcaaaacagggaaggagagcttgaaggaagtgccccg
ggagtcaccctggtgtctgtgaccaaggaatatgagggccacaaggctgtggtccaagac
ctcagcctgaccttctacagagaccaaatcaccgccctgctggggacaaacggtgccggg
aaaaccactatcatatccatgttgacggggctccaccctcccacttctggaaccatcatc
atcaatggcaagaacctacagacagacctgtcgagggtcagaatggagcttggtgtgtgt
ccgcagcaggacatcctgttggacaacctcaccgtccgggaacatttgctgctctttgct
tccataaaggcgcctcagtggaccaagaaggagctgcatcagcaagtcaatcaaactctt
caggatgtggacttaactcagcatcagcacaaacagacccgagctctgtctggaggcctg
aagaggaagctctcccttggcattgctttcatgggcatgtcgaggaccgtggttctggat
gagcccaccagtggggtggacccttgctcccggcatagcctgtgggacattctgctcaag
taccgagaaggtcgtacgatcatcttcacaacccaccacctggatgaagctgaagcgctg
agtgaccgcgtggccgtcctccagcatgggaggctcaggtgctgcggtcctcccttctgc
ctgaaggaggcatatggccaggggctccgcctgacactcacgaggcagccttctgttctg
gaggcccatgatctgaaagacatggcttgtgttacatccctgataaagatctatattcca
caagcatttctcaaagacagcagtggaagtgagctgacctacaccattccaaaggacaca
gacaaggcctgcttgaaagggctcttccaggccctggatgagaacctgcatcagctgcac
ctgacgggctatgggatctcagacaccaccttagaagaggtgtttttgatgcttttgcaa
gattccaacaagaaatctcacattgccctggggactgagtcagagctgcagaaccacagg
cctacaggacatctgtctggctactgtggctccctagcacggcccgcaactgtgcagggc
gtccagctgctccgcgcacaagtggccgcgatcctggcccggaggctccgccgcacgctg
cgcgccgggaagagcaccctcgccgacctgctgctgccagtcctcttcgtggccttggcc
atgggcttgttcatggtgagacccctggccaccgagtaccctcccctcagactcacacct
ggacattaccagcgggccgagacctactttttcagcagtgggggcgacaacttggacctc
acccgtgtgcttctgcggaagtttagagatcaagatttgccctgtgcagatttaaaccca
cgccagaagaattcttcatgctggcgcacagatcccttttctcacccagaattccaggat
tcatgtggctgcctgaagtgtccaaatagaagtgctagtgctccctacctgaccaaccac
ctgggccacacactgttgaatctctcaggcttcaatatggaggagtacttgctggcacca
tctgaaaaaccaaggcttggaggttggtcttttggattaaaaatccccagtgaagctgga
ggtgcaaatggaaacatatcaaaacccccaactctggcaaaggtgtggtataatcagaag
ggttttcattccctaccttcctacttaaatcatctaaacaaccttattttgtggcagcac
ctaccccctactgtggactggagacaatacggaataacactctacagccacccatatgga
ggggccttgctgaacaaggacaagatcctggagagcatccgtcagtgtggagtggccctc
tgcatcgtgctgggattctccatcctgtctgcatccatcggcagctctgtggtgagggac
agggtgattggagccaaaaggttgcagcacataagtggccttggctacaggatgtactgg
ttcacaaacttcctatatgacatgctcttttacttggtttccgtctgcctgtgtgttgcc
gttattgtcgccttccagttaacagcttttactttccgcaagaacttggcagccacggcc
ctcctgctgtcacttttcggatatgcaactcttccatggatgtacctgatgtccagaatc
ttttccagttcggacgtggctttcatttcctatgtctcactaaacttcatctttggcctt
tgtaccatgctcataaccattatgccccggttgctagccatcatctccaaagctaagaat
ttacagaatatctatgatgtcctcaagtgggtctttactatttttcctcaattctgtctt
ggtcaaggactggtagaactctgctataatcagatcaaatatgacctgacccacaacttc
ggcattgattcctatgtgagtccctttgagatgaactttctgggctggatcttcgtgcaa
ctggcctcgcagggcacagtacttctcctcttgagggttctgctacactgggaccttctg
cgatggccaaggggtcattctactctccaaggcacagtcaaatcttctaaggatacagat
gttgaaaaagaggaaaagagagtgtttgaaggaaggaccaatggagacattcttgtgtta
tacaaccttagtaaacattatcgacgctttttccagaatattattgctgtgcaagatatt
agtttgggcataccaaaaggagagtgctttggacttctaggggtgaatggagctgggaag
agcacgactttcaaaatgctgaatggtgaagtttctctaacttcaggacatgctatcatc
aggactcccatgggagacgccgtggacctgtcttctgctggcacggcaggcgtgctcatt
ggctactgtccccagcaggatgccctggacgagcttctgactggttgggaacatctctat
tattactgtagcttacgcgggattccaaggcagtgcatccctgaggttgctggagacctc
atcaggcgcttacacctcgaagcccacgcggacaaacctgtggccacctacagtggggga
accaagcggaaactctctacagccctggccctggtggggaaacctgacattcttttattg
gatgagcccagctctgggatggatccctgctctaagcggtacctgtggcaaacaataatg
aaggaggttcgggaaggctgtgctgcggtgctgacctcccacagcatggaggagtgtgag
gctctttgcacaagactggccataatggttaacggcagcttcaaatgtcttggttctcct
cagcacatcaaaaataggtttggtgatggttatacagtcaaagtttggctctgtaaggaa
gcaaatcaacattgcactgtttctgaccacttgaagctttattttccaggaattcagttc
aagggacagcacctgaatttattagaatatcatgtgccaaaaagatggggatgcctagct
gacttgttcaaagttatagagaacaataaaaccttcttgaatattaagcattattccatt
aaccaaaccactttggagcaggtatttattaattttgcttctgagcagcagcaaactcta
caatctactcttgatccatccactgacagtcaccacacacatcacttgcccatctga

DBGET integrated database retrieval system