KEGG   Homo sapiens (human): 1548Help
Entry
1548              CDS       T01001                                 

Gene name
CYP2A6, CPA6, CYP2A, CYP2A3, CYPIIA6, P450C2A, P450PB
Definition
cytochrome P450, family 2, subfamily A, polypeptide 6 (EC:1.14.14.1)
Orthology
K17683  
cytochrome P450, family 2, subfamily A, polypeptide 6 [EC:1.14.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
Caffeine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1548 (CYP2A6)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    1548 (CYP2A6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1548 (CYP2A6)
   00982 Drug metabolism - cytochrome P450
    1548 (CYP2A6)
   00983 Drug metabolism - other enzymes
    1548 (CYP2A6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    1548 (CYP2A6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     1548 (CYP2A6)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1548 (CYP2A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 494 aa AA seqDB search
MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSN
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSN
VISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQL
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFI
GGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQ
RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggatgcttctggtggccttgctggtctgcctgactgtaatggtcttg
atgtctgtttggcagcagaggaagagcaaggggaagctgcctccgggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtacaactccctcatgaag
atcagtgagcgctatggccccgtgttcaccattcacttggggccccggcgggtcgtggtg
ctgtgtggacatgatgccgtcagggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaagccaccttcgactgggtcttcaaaggctatggcgtggtattcagcaac
ggggagcgcgccaagcagctccggcgcttctccatcgccaccctgcgggacttcggggtg
ggcaagcgaggcatcgaggagcgcatccaggaggaggcgggcttcctcatcgacgccctc
cggggcactggcggcgccaatatcgatcccaccttcttcctgagccgcacagtctccaat
gtcatcagctccattgtctttggggaccgctttgactataaggacaaagagttcctgtca
ctgttgcgcatgatgctaggaatcttccagttcacgtcaacctccacggggcagctctat
gagatgttctcttcggtgatgaaacacctgccaggaccacagcaacaggcctttcagttg
ctgcaagggctggaggacttcatagccaagaaggtggagcacaaccagcgcacgctggat
cccaattccccacgggacttcattgactcctttctcatccgcatgcaggaggaggagaag
aaccccaacacggagttctacttgaaaaacctggtgatgaccacgttgaacctcttcatt
gggggcaccgagaccgtcagcaccaccctgcgctatggcttcttgctgctcatgaagcac
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccgggccaagatgccctacatggaggcagtgatccacgagatccaa
agatttggagacgtgatccccatgagtttggcccgcagagtcaaaaaggacaccaagttt
cgggatttcttcctccctaagggcaccgaagtgtaccctatgctgggctctgtgctgaga
gaccccagtttcttctccaacccccaggacttcaatccccagcacttcctgaatgagaag
gggcagtttaagaagagtgatgcttttgtgcccttttccatcggaaagcggaactgtttc
ggagaaggcctggccagaatggagctctttctcttcttcaccaccgtcatgcagaacttc
cgcctcaagtcctcccagtcacctaaggacattgacgtgtcccccaaacacgtgggcttt
gccacgatcccacgaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system