KEGG   Homo sapiens (human): 154810Help
Entry
154810            CDS       T01001                                 

Gene name
AMOTL1, JEAP
Definition
(RefSeq) angiomotin like 1
  KO
K06104  
angiomotin like
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    154810 (AMOTL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8IY63(Tbio)
UniProt: 
Position
11q21
AA seq 956 aa AA seqDB search
MWRAKLRRGTCEPAVKGSPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATS
SIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLA
IQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQ
PQQNNEELPTYEEAKAQSQFFRGQQQQQQQQGAVGHGYYMAGGTSQKSRTEGRPTVNRAN
SGQAHKDEALKELKQGHVRSLSERIMQLSLERNGAKQHLPGSGNGKGFKVGGGPSPAQPA
GKVLDPRGPPPEYPFKTKQMMSPVSKTQEHGLFYGDQHPGMLHEMVKPYPAPQPVRTDVA
VLRYQPPPEYGVTSRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQP
PPAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRIS
EAYESLVKSTTKRESLDKAMRNKLEGEIRRLHDFNRDLRDRLETANRQLSSREYEGHEDK
AAEGHYASQNKEFLKEKEKLEMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELR
EKQAYVEKVEKLQQALTQLQSACEKREQMERRLRTWLERELDALRTQQKHGNGQPANMPE
YNAPALLELVREKEERILALEADMTKWEQKYLEESTIRHFAMNAAATAAAERDTTIINHS
RNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIKVLQQRSRKDA
GKTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEH
ASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLS
TTPAHSPVLKHPAAKGTAEKLENSPGHGKSPDHRGRVSSLLHKPEFPDGEMMEVLI
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgtggagggcaaagttgcgccggggaacttgtgagcctgcggtgaaagggtccccttct
gcttgttatagccccagtagtcctgtccaggttctagaagactccacctacttttcccca
gactttcagctctattctgggaggcatgaaacatctgctttgacggtggaggcaaccagt
agcatcagggaaaaagttgttgaagatcctctttgtaacttccactccccaaacttcctg
aggatctcagaggtggaaatgagaggttccgaggatgcggcagctggaacagtattgcag
cggctgatccaggaacaactgcggtatggcaccccaaccgagaacatgaacttgctggcc
attcagcaccaggccacagggagtgcaggaccagcccatcctacaaacaacttttcttcc
acggaaaacctcactcaagaagacccacaaatggtctaccagtcagcacgccaagaaccg
cagggtcaagaacaccaggtggacaatacggtgatggagaaacaggtccggtccacgcag
cctcagcagaacaacgaggaactgcccacttacgaggaggccaaagcacagtcgcagttc
ttcagggggcagcagcagcagcaacagcagcagggggcggtgggccatggttactacatg
gcagggggcaccagtcagaagtcccgaactgaggggaggcccactgtgaaccgtgccaac
agtggacaggcgcataaggacgaggcgctgaaggaactgaagcagggccacgtccgctcg
ctcagcgagagaatcatgcagctgtccctggagaggaatggggccaagcaacaccttccc
ggctcggggaatggaaagggcttcaaagtaggaggggggccctcccctgcccagcctgca
ggtaaagtgctggaccctcggggtcctccacctgagtaccccttcaagaccaagcaaatg
atgtccccagtcagcaagacccaggagcacggacttttttatggtgaccagcaccccggg
atgctccacgagatggtcaagccctaccctgctcctcagcctgtgagaacagatgtggcc
gtcctgcggtaccagccaccccctgagtatggggtaacgagccgcccatgccaacttccg
ttcccatcaaccatgcagcagcacagccccatgtcctcccagacctcttccgccagcggg
ccactgcactctgtctccctgccgcttccactcccgatggccctgggtgctccacagccc
ccgcctgccgcctcccccagccagcagcttggtccagatgcctttgcgattgtggagcga
gcccagcaaatggtggagatattaacagaggagaaccgggtgcttcaccaggaacttcag
ggttactacgacaatgccgacaagctccacaagtttgaaaaagaacttcagagaatttcg
gaagcctatgaaagtctggtcaagtctaccaccaagcgagaatcgctggacaaggccatg
agaaacaaattggaaggcgagattagaagacttcatgatttcaacagagacctccgagat
cgactagagactgctaacaggcaactatccagcagggaatacgaagggcatgaagacaaa
gctgcagaggggcattatgcttcccagaacaaagaattcttgaaggaaaaggagaaatta
gaaatggagttagcagcagtgcggactgcaagtgaggaccatcggagacacatcgagatc
ctggaccaggctttgagcaacgcccaggccagggtcatcaagctggaagaggagttacga
gagaagcaagcatatgttgagaaagttgagaagctgcagcaggccctgacccagctgcag
tctgcatgtgagaagcgagaacagatggagcggagactgcggacttggctggagagagag
ctggatgcactgagaacccagcagaaacatggaaatggccagccagccaacatgccggaa
tacaatgccccagccctcctggaacttgtgcgggagaaggaggagcggatcctggccctg
gaggccgacatgacaaagtgggagcagaagtacctggaggagagcaccatccgacacttt
gccatgaatgccgcagccactgcagcagctgagagggacaccacgatcatcaaccactca
cggaatggcagctacggagagagctcgctggaggcccacatctggcaagaggaggaggag
gtggtgcaggccaacagaaggtgtcaggacatggaatacactattaaaaatctccatgcc
aaaatcatagagaaagatgctatgattaaggtcctgcagcagcgatctcgtaaagatgcc
gggaagacagactcctccagcctacgtcctgcccgctccgttccatccatagcagcagct
actgggacacactctcgccagacctctcttaccagcagccagctggctgaggaaaagaag
gaagagaagacctggaaggggagcataggattgctgctggggaaggagcaccatgagcat
gcctctgccccactgctgccacccccacccacctcagcactgtcctccatagcctccact
acggcagccagcagtgcccacgccaagacaggcagcaaggacagcagcacacagactgac
aagagtgccgagctcttctggcccagcatggcctcccttcccagccgcggccggctgagc
acgacccctgctcacagccccgtcctgaaacacccagcggccaaagggaccgcagagaaa
ctggagaactctcctggccatgggaagtcgcctgaccacagaggccgggtcagcagcttg
ctgcacaagcccgagttccctgatggagagatgatggaagtcctcatctaa

DBGET integrated database retrieval system