KEGG   Homo sapiens (human): 154881Help
Entry
154881            CDS       T01001                                 

Gene name
KCTD7, CLN14, EPM3
Definition
potassium channel tetramerization domain containing 7
Organism
hsa  Homo sapiens (human)
Disease
H00810  
Progressive myoclonic epilepsy (PME/ EPM)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.21
AA seq 288 aa AA seqDB search
MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPEVVPLNIGGA
HFTTRLSTLRCYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRSGDLPPRE
RVRAVYKEAQYYAIGPLLEQLENMQPLKGEKVRQAFLGLMPYYKDHLERIVEIARLRAVQ
RKARFAKLKVCVFKEEMPITPYECPLLNSLRFERSESDGQLFEHHCEVDVSFGPWEAVAD
VYDLLHCLVTDLSAQGLTVDHQCIGVCDKHLVNHYYCKRPIYEFKITW
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggtggtagtcacggggcgggagccagacagccgtcgtcaggacggtgccatgtccagc
tctgacgccgaagacgactttctggagccggccacgccgacggccacgcaggcggggcac
gcgctgcccctgctgccacaggagtttcctgaggttgttccccttaacatcggaggggct
cacttcactacacgcctgtccacactgcggtgctacgaagacaccatgttggcagccatg
ttcagtgggcggcactacatccccacggactccgagggccggtacttcatcgaccgagat
ggcacacactttggagatgtgctgaatttcctgcgctcaggggacctcccacccagggag
cgtgttcgagctgtgtacaaagaggcccagtactatgccatcgggcccctcctggagcag
ctggagaacatgcagccactgaagggcgagaaggtgcgccaagcgtttctgggactcatg
ccctattacaaagaccacttggagcggattgtggagatcgcccggctgcgtgcggtccag
cggaaggcccgctttgccaagctcaaggtctgtgtcttcaaggaggagatgcccatcacc
ccctatgagtgtccgctcctcaactccctgcgatttgagcggagtgagagtgacgggcag
ctttttgagcaccactgtgaagtggatgtgtcttttgggccctgggaggctgtggctgat
gtttatgacctgctgcactgcctggtcacggacctctcggcccagggtctcaccgtggac
caccagtgcatcggggtgtgtgacaagcacctcgtgaaccactactactgcaagcgcccc
atctatgagttcaagatcacatggtga

DBGET integrated database retrieval system