KEGG   Homo sapiens (human): 154881Help
Entry
154881            CDS       T01001                                 

Gene name
KCTD7, CLN14, EPM3
Definition
(RefSeq) potassium channel tetramerization domain containing 7
  KO
K21917  
BTB/POZ domain-containing protein KCTD7/14
Organism
hsa  Homo sapiens (human)
Disease
H00810  
Progressive myoclonic epilepsy (PME/ EPM)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     154881 (KCTD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q96MP8(Tbio)
UniProt: 
Position
7q11.21
AA seq 289 aa AA seqDB search
MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPEVVPLNIGGA
HFTTRLSTLRCYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRSGDLPPRE
RVRAVYKEAQYYAIGPLLEQLENMQPLKGEKVRQAFLGLMPYYKDHLERIVEIARLRAVQ
RKARFAKLKVCVFKEEMPITPYECPLLNSLRFERSESDGQLFEHHCEVDVSFGPWEAVAD
VYDLLHCLVTDLSAQGLTVDHQCIGVCDKHLVNHYYCKRPIYEFKITWW
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggtggtagtcacggggcgggagccagacagccgtcgtcaggacggtgccatgtccagc
tctgacgccgaagacgactttctggagccggccacgccgacggccacgcaggcggggcac
gcgctgcccctgctgccacaggagtttcctgaggttgttccccttaacatcggaggggct
cacttcactacacgcctgtccacactgcggtgctacgaagacaccatgttggcagccatg
ttcagtgggcggcactacatccccacggactccgagggccggtacttcatcgaccgagat
ggcacacactttggagatgtgctgaatttcctgcgctcaggggacctcccacccagggag
cgtgttcgagctgtgtacaaagaggcccagtactatgccatcgggcccctcctggagcag
ctggagaacatgcagccactgaagggcgagaaggtgcgccaagcgtttctgggactcatg
ccctattacaaagaccacttggagcggattgtggagatcgcccggctgcgtgcggtccag
cggaaggcccgctttgccaagctcaaggtctgtgtcttcaaggaggagatgcccatcacc
ccctatgagtgtccgctcctcaactccctgcgatttgagcggagtgagagtgacgggcag
ctttttgagcaccactgtgaagtggatgtgtcttttgggccctgggaggctgtggctgat
gtttatgacctgctgcactgcctggtcacggacctctcggcccagggtctcaccgtggac
caccagtgcatcggggtgtgtgacaagcacctcgtgaaccactactactgcaagcgcccc
atctatgagttcaagatcacatggtggtga

DBGET integrated database retrieval system