KEGG   Homo sapiens (human): 1549Help
Entry
1549              CDS       T01001                                 

Gene name
CYP2A7, CPA7, CPAD, CYP2A, CYPIIA7, P450-IIA4
Definition
cytochrome P450, family 2, subfamily A, polypeptide 7 (EC:1.14.14.1)
Orthology
K17684  
cytochrome P450, family 2, subfamily A, polypeptide 7 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 494 aa AA seqDB search
MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMK
FSECYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSN
GERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKL
LQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQ
RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVF
ATIPRNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgcttctggtggccttgctggcctgcctgactgtgatggtcttg
atgtctgtctggcagcagaggaagagcagggggaagctgcctccgggacccaccccactg
cccttcattggaaactacctccagctgaacacagagcacatatgtgactccatcatgaag
ttcagtgagtgctatggccccgtgttcaccattcacttggggccccggcgggtcgtggtg
ctgtgtggacatgatgccgtcagggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaagccaccttcgactgggtcttcaaaggctatggcgtggcgttcagcaac
ggggagcgcgccaagcagctcctgcgctttgccatcgccaccctgagggacttcggggtg
ggcaagcgaggcatcgaggagcgcatccaggaggagtcgggcttcctcatcgaggccatc
cggagcacgcacggcgccaatatcgatcccaccttcttcctgagccgcacagtctccaat
gtcatcagctccattgtctttggggaccgctttgactatgaggacaaagagttcctgtca
ctgctgagcatgatgctaggaatcttccagttcacgtcaacctccacggggcagctctat
gagatgttctcttcggtgatgaaacacctgccaggaccacagcaacaggcctttaagttg
ctgcaagggctggaggacttcatagccaagaaggtggagcacaaccagcgcacgctggat
cccaattccccacaggacttcatcgactcctttctcatccacatgcaggaggaggagaag
aaccccaacacggagttctacttgaagaacctgatgatgagcacgttgaacctcttcatt
gcaggcaccgagacggtcagcaccaccctgcgctatggcttcttgctgctcatgaagcac
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccggaccaagatgccctacatggaggcagtgatccacgagatccaa
agatttggagacgtgatccccatgagtttggcccgcagggttaaaaaggacaccaagttt
cgggattttttcctccctaagggcaccgaagtgttccctatgctgggctccgtgctgaga
gaccccagcttcttctccaaccctcaggacttcaatccccagcatttcctggatgacaag
gggcagtttaagaagagtgatgcttttgtgcccttttccatcggaaagcggaactgtttc
ggagaaggcctggccagaatggagctctttctcttcttcaccaccgtcatgcagaacttc
cgcctcaagtcctcccagtcacctaaggacattgacgtgtcccccaaacacgtggtcttt
gccacgatcccacgaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system