KEGG   Homo sapiens (human): 1549Help
Entry
1549              CDS       T01001                                 

Gene name
CYP2A7, CPA7, CPAD, CYP2A, CYPIIA7, P450-IIA4
Definition
cytochrome P450, family 2, subfamily A, polypeptide 7 (EC:1.14.14.1)
Orthology
K17684  
cytochrome P450, family 2, subfamily A, polypeptide 7 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1549 (CYP2A7)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1549 (CYP2A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 494 aa AA seqDB search
MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMK
FSECYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSN
GERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKL
LQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQ
RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVF
ATIPRNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgcttctggtggccttgctggcctgcctgactgtgatggtcttg
atgtctgtctggcagcagaggaagagcagggggaagctgcctccgggacccaccccactg
cccttcattggaaactacctccagctgaacacagagcacatatgtgactccatcatgaag
ttcagtgagtgctatggccccgtgttcaccattcacttggggccccggcgggtcgtggtg
ctgtgtggacatgatgccgtcagggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaagccaccttcgactgggtcttcaaaggctatggcgtggcgttcagcaac
ggggagcgcgccaagcagctcctgcgctttgccatcgccaccctgagggacttcggggtg
ggcaagcgaggcatcgaggagcgcatccaggaggagtcgggcttcctcatcgaggccatc
cggagcacgcacggcgccaatatcgatcccaccttcttcctgagccgcacagtctccaat
gtcatcagctccattgtctttggggaccgctttgactatgaggacaaagagttcctgtca
ctgctgagcatgatgctaggaatcttccagttcacgtcaacctccacggggcagctctat
gagatgttctcttcggtgatgaaacacctgccaggaccacagcaacaggcctttaagttg
ctgcaagggctggaggacttcatagccaagaaggtggagcacaaccagcgcacgctggat
cccaattccccacaggacttcatcgactcctttctcatccacatgcaggaggaggagaag
aaccccaacacggagttctacttgaagaacctgatgatgagcacgttgaacctcttcatt
gcaggcaccgagacggtcagcaccaccctgcgctatggcttcttgctgctcatgaagcac
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccggaccaagatgccctacatggaggcagtgatccacgagatccaa
agatttggagacgtgatccccatgagtttggcccgcagggttaaaaaggacaccaagttt
cgggattttttcctccctaagggcaccgaagtgttccctatgctgggctccgtgctgaga
gaccccagcttcttctccaaccctcaggacttcaatccccagcatttcctggatgacaag
gggcagtttaagaagagtgatgcttttgtgcccttttccatcggaaagcggaactgtttc
ggagaaggcctggccagaatggagctctttctcttcttcaccaccgtcatgcagaacttc
cgcctcaagtcctcccagtcacctaaggacattgacgtgtcccccaaacacgtggtcttt
gccacgatcccacgaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system