KEGG   Homo sapiens (human): 155066Help
Entry
155066            CDS       T01001                                 

Gene name
ATP6V0E2, ATP6V0E2L, C7orf32
Definition
ATPase, H+ transporting V0 subunit e2
Orthology
K02153  
V-type H+-transporting ATPase subunit e
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Excretory system; Collecting duct acid secretion [PATH:hsa04966]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q36.1
AA seq 213 aa AA seqDB search
MRVRGPARLIASGARLLLRMLSALPGWGPAHLQRPLLGPASCLGILRPAMTAHSFALPVI
IFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLLCPALGMTVAPLSLTTPSSGP
SPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQPARALGSPGHSSGRGDVLLQYPHCS
GVCPLSQGDAAGELVWVGSFPLQTGQMPGLSPS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgcgcggcccggcccggctgatcgcttcgggtgctcgactcctgttgcgcatg
ctcagcgcgctgcccggctggggacccgcgcacctgcagcgcccgctgctcggccctgca
tcctgcctgggcatcctgcgcccggccatgacggcgcactcattcgccctcccggtcatc
atcttcaccacgttctggggcctcgtcggcatcgccgggccctggttcgtgccgaaggga
cccaaccgcggagtgatcatcaccatgctggtcgccaccgccgtctgctgttacctcttg
tgcccagctctcggaatgactgtggctccactgtccctgacaaccccttcgtccggaccc
tcccccacacaactatgtctggtcaccagctccctcctgctggcacccagagacccggac
ccgcagggcctgcctggttcctggaagtcttcccagtcttcccagccagcccgggccctg
gggagccctgggcacagcagcggccgaggggatgtcctgctccaatacccgcactgctct
ggagtttgccctctttcccaaggagatgctgctggggagctggtatgggtggggtctttc
cctttacagacggggcagatgccaggactcagcccatcctga

DBGET integrated database retrieval system