KEGG   Homo sapiens (human): 155066Help
Entry
155066            CDS       T01001                                 

Gene name
ATP6V0E2, ATP6V0E2L, C7orf32
Definition
(RefSeq) ATPase H+ transporting V0 subunit e2
  KO
K02153  
V-type H+-transporting ATPase subunit e
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    155066 (ATP6V0E2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    155066 (ATP6V0E2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    155066 (ATP6V0E2)
  Nervous system
   04721 Synaptic vesicle cycle
    155066 (ATP6V0E2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    155066 (ATP6V0E2)
  Infectious diseases
   05110 Vibrio cholerae infection
    155066 (ATP6V0E2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    155066 (ATP6V0E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NHE4(Tdark)
UniProt: 
Position
7q36.1
AA seq 130 aa AA seqDB search
MRVRGPARLIASGARLLLRMLSALPGWGPAHLQRPLLGPASCLGILRPAMTAHSFALPVI
IFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNE
TIWYVRFLWE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgcgcggcccggcccggctgatcgcttcgggtgctcgactcctgttgcgcatg
ctcagcgcgctgcccggctggggacccgcgcacctgcagcgcccgctgctcggccctgca
tcctgcctgggcatcctgcgcccggccatgacggcgcactcattcgccctcccggtcatc
atcttcaccacgttctggggcctcgtcggcatcgccgggccctggttcgtgccgaaggga
cccaaccgcggagtgatcatcaccatgctggtcgccaccgccgtctgctgttacctcttc
tggctcatcgccatcctggcgcagctgaaccccctgttcgggccccagctgaagaatgag
accatctggtacgtgcgcttcctgtgggagtga

DBGET integrated database retrieval system