KEGG   Homo sapiens (human): 1553Help
Entry
1553              CDS       T01001                                 

Gene name
CYP2A13, CPAD, CYP2A, CYPIIA13
Definition
cytochrome P450, family 2, subfamily A, polypeptide 13 (EC:1.14.14.1)
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:hsa00980]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 494 aa AA seqDB search
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFF
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgcttctggtgaccttgctggcctgcctgactgtgatggtcttg
atgtcagtctggcggcagaggaagagcagggggaagctgcctccgggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtacaactccctcatgaag
atcagtgagcgctatggccctgtgttcaccattcacttggggccccggcgggtcgtggtg
ctgtgcggacatgatgccgtcaaggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaggccaccttcgactggctcttcaaaggctatggcgtggcgttcagcaac
ggggagcgcgccaagcagctccggcgcttctccatcgccaccctaaggggttttggcgtg
ggcaagcgcggcatcgaggaacgcatccaggaggaggcgggcttcctcatcgacgccctc
cggggcacgcacggcgccaatatcgatcccaccttcttcctgagccgcacagtctccaat
gtcatcagctccattgtctttggggaccgctttgactatgaggacaaagagttcctgtca
ctgttgcgcatgatgctgggaagcttccagttcacggcaacctccacggggcagctctat
gagatgttctcttcggtgatgaaacacctgccaggaccacagcaacaggcctttaaggag
ctgcaagggctggaggacttcatcgccaagaaggtggagcacaaccagcgcacgctggat
cccaattccccacgggacttcatcgactcctttctcatccgcatgcaggaggaggagaag
aaccccaacacagagttctacttgaagaacctggtgatgaccaccctgaacctcttcttt
gcgggcactgagaccgtgagcaccaccctgcgctacggtttcctgctgctcatgaagcac
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccgggccaagatgccctacacagaggcagtgatccacgagatccaa
agatttggagacatgctccccatgggtttggcccacagggtcaacaaggacaccaagttt
cgggatttcttcctccctaagggcactgaagtgttccctatgctgggctccgtgctgaga
gaccccaggttcttctccaacccccgggacttcaatccccagcacttcctggataagaag
gggcagtttaagaagagtgatgcttttgtgcccttttccatcggaaagcggtactgtttt
ggagaaggcctggccagaatggagctctttctcttcttcaccaccatcatgcagaacttt
cgcttcaagtcccctcagtcgcctaaggatatcgacgtgtcccccaaacacgtgggcttt
gccacgatcccacgaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system