KEGG   Homo sapiens (human): 1553Help
Entry
1553              CDS       T01001                                 

Gene name
CYP2A13, CPAD, CYP2A, CYPIIA13
Definition
cytochrome P450, family 2, subfamily A, polypeptide 13 (EC:1.14.14.1)
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1553 (CYP2A13)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    1553 (CYP2A13)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1553 (CYP2A13)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1553 (CYP2A13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 494 aa AA seqDB search
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFF
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgcttctggtgaccttgctggcctgcctgactgtgatggtcttg
atgtcagtctggcggcagaggaagagcagggggaagctgcctccgggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtacaactccctcatgaag
atcagtgagcgctatggccctgtgttcaccattcacttggggccccggcgggtcgtggtg
ctgtgcggacatgatgccgtcaaggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaggccaccttcgactggctcttcaaaggctatggcgtggcgttcagcaac
ggggagcgcgccaagcagctccggcgcttctccatcgccaccctaaggggttttggcgtg
ggcaagcgcggcatcgaggaacgcatccaggaggaggcgggcttcctcatcgacgccctc
cggggcacgcacggcgccaatatcgatcccaccttcttcctgagccgcacagtctccaat
gtcatcagctccattgtctttggggaccgctttgactatgaggacaaagagttcctgtca
ctgttgcgcatgatgctgggaagcttccagttcacggcaacctccacggggcagctctat
gagatgttctcttcggtgatgaaacacctgccaggaccacagcaacaggcctttaaggag
ctgcaagggctggaggacttcatcgccaagaaggtggagcacaaccagcgcacgctggat
cccaattccccacgggacttcatcgactcctttctcatccgcatgcaggaggaggagaag
aaccccaacacagagttctacttgaagaacctggtgatgaccaccctgaacctcttcttt
gcgggcactgagaccgtgagcaccaccctgcgctacggtttcctgctgctcatgaagcac
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccgggccaagatgccctacacagaggcagtgatccacgagatccaa
agatttggagacatgctccccatgggtttggcccacagggtcaacaaggacaccaagttt
cgggatttcttcctccctaagggcactgaagtgttccctatgctgggctccgtgctgaga
gaccccaggttcttctccaacccccgggacttcaatccccagcacttcctggataagaag
gggcagtttaagaagagtgatgcttttgtgcccttttccatcggaaagcggtactgtttt
ggagaaggcctggccagaatggagctctttctcttcttcaccaccatcatgcagaacttt
cgcttcaagtcccctcagtcgcctaaggatatcgacgtgtcccccaaacacgtgggcttt
gccacgatcccacgaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system