KEGG   Homo sapiens (human): 1555Help
Entry
1555              CDS       T01001                                 

Gene name
CYP2B6, CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6, EFVM, IIB1, P450
Definition
cytochrome P450, family 2, subfamily B, polypeptide 6 (EC:1.14.14.1)
Orthology
K17709  
cytochrome P450, family 2, subfamily B, polypeptide 6 [EC:1.14.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    1555 (CYP2B6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1555 (CYP2B6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1555 (CYP2B6)
   00982 Drug metabolism - cytochrome P450
    1555 (CYP2B6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     1555 (CYP2B6)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1555 (CYP2B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 491 aa AA seqDB search
MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNR
WKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIIC
SIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFS
DLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL
KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKI
PPTYQIRFLPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaactcagcgtcctcctcttccttgcactcctcacaggactcttgctactcctggtt
cagcgccaccctaacacccatgaccgcctcccaccagggccccgccctctgccccttttg
ggaaaccttctgcagatggatagaagaggcctactcaaatcctttctgaggttccgagag
aaatatggggacgtcttcacggtacacctgggaccgaggcccgtggtcatgctgtgtgga
gtagaggccatacgggaggcccttgtggacaaggctgaggccttctctggccggggaaaa
atcgccatggtcgacccattcttccggggatatggtgtgatctttgccaatggaaaccgc
tggaaggtgcttcggcgattctctgtgaccactatgagggacttcgggatgggaaagcgg
agtgtggaggagcggattcaggaggaggctcagtgtctgatagaggagcttcggaaatcc
aagggggccctcatggaccccaccttcctcttccagtccattaccgccaacatcatctgc
tccatcgtctttggaaaacgattccactaccaagatcaagagttcctgaagatgctgaac
ttgttctaccagactttttcactcatcagctctgtattcggccagctgtttgagctcttc
tctggcttcttgaaatactttcctggggcacacaggcaagtttacaaaaacctgcaggaa
atcaatgcttacattggccacagtgtggagaagcaccgtgaaaccctggaccccagcgcc
cccaaggacctcatcgacacctacctgctccacatggaaaaagagaaatccaacgcacac
agtgaattcagccaccagaacctcaacctcaacacgctctcgctcttctttgctggcact
gagaccaccagcaccactctccgctacggcttcctgctcatgctcaaataccctcatgtt
gcagagagagtctacagggagattgaacaggtgattggcccacatcgccctccagagctt
catgaccgagccaaaatgccatacacagaggcagtcatctatgagattcagagattttcc
gaccttctccccatgggtgtgccccacattgtcacccaacacaccagcttccgagggtac
atcatccccaaggacacagaagtatttctcatcctgagcactgctctccatgacccacac
tactttgaaaaaccagacgccttcaatcctgaccactttctggatgccaatggggcactg
aaaaagactgaagcttttatccccttctccttagggaagcggatttgtcttggtgaaggc
atcgcccgtgcggaattgttcctcttcttcaccaccatcctccagaacttctccatggcc
agccccgtggccccagaagacatcgatctgacaccccaggagtgtggtgtgggcaaaata
cccccaacataccagatccgcttcctgccccgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system