KEGG   Homo sapiens (human): 156Help
Entry
156               CDS       T01001                                 

Gene name
GRK2, ADRBK1, BARK1, BETA-ARK1
Definition
(RefSeq) G protein-coupled receptor kinase 2 (EC:2.7.11.15)
  KO
K00910  
beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Endocytosis
Hedgehog signaling pathway
Glutamatergic synapse
Olfactory transduction
Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    156 (GRK2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    156 (GRK2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    156 (GRK2)
  Nervous system
   04724 Glutamatergic synapse
    156 (GRK2)
  Sensory system
   04740 Olfactory transduction
    156 (GRK2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    156 (GRK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     156 (GRK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  GRK family [OT]
   156 (GRK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   156 (GRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 689 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLAC
SHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLVQRGSANGL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgacgtgagctacctgatggccatggagaagagc
aaggccacgccggccgcgcgcgccagcaagaagatcctgctgcccgagcccagcatccgc
agtgtcatgcagaagtacctggaggaccggggcgaggtgacctttgagaagatcttttcc
cagaagctggggtacctgctcttccgagacttctgcctgaaccacctggaggaggccagg
cccttggtggaattctatgaggagatcaagaagtacgagaagctggagacggaggaggag
cgtgtggcccgcagccgggagatcttcgactcatacatcatgaaggagctgctggcctgc
tcgcatcccttctcgaagagtgccactgagcatgtccaaggccacctggggaagaagcag
gtgcctccggatctcttccagccatacatcgaagagatttgtcaaaacctccgaggggac
gtgttccagaaattcattgagagcgataagttcacacggttttgccagtggaagaatgtg
gagctcaacatccacctgaccatgaatgacttcagcgtgcatcgcatcattgggcgcggg
ggctttggcgaggtctatgggtgccggaaggctgacacaggcaagatgtacgccatgaag
tgcctggacaaaaagcgcatcaagatgaagcagggggagaccctggccctgaacgagcgc
atcatgctctcgctcgtcagcactggggactgcccattcattgtctgcatgtcatacgcg
ttccacacgccagacaagctcagcttcatcctggacctcatgaacggtggggacctgcac
taccacctctcccagcacggggtcttctcagaggctgacatgcgcttctatgcggccgag
atcatcctgggcctggagcacatgcacaaccgcttcgtggtctaccgggacctgaagcca
gccaacatccttctggacgagcatggccacgtgcggatctcggacctgggcctggcctgt
gacttctccaagaagaagccccatgccagcgtgggcacccacgggtacatggctccggag
gtcctgcagaagggcgtggcctacgacagcagtgccgactggttctctctggggtgcatg
ctcttcaagttgctgcgggggcacagccccttccggcagcacaagaccaaagacaagcat
gagatcgaccgcatgacgctgacgatggccgtggagctgcccgactccttctcccctgaa
ctacgctccctgctggaggggttgctgcagagggatgtcaaccggagattgggctgcctg
ggccgaggggctcaggaggtgaaagagagcccctttttccgctccctggactggcagatg
gtcttcttgcagaagtaccctcccccgctgatccccccacgaggggaggtgaacgcggcc
gacgccttcgacattggctccttcgatgaggaggacacaaaaggaatcaagttactggac
agtgatcaggagctctaccgcaacttccccctcaccatctcggagcggtggcagcaggag
gtggcagagactgtcttcgacaccatcaacgctgagacagaccggctggaggctcgcaag
aaagccaagaacaagcagctgggccatgaggaagactacgccctgggcaaggactgcatc
atgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcggtac
ttctacctgttccccaaccgcctcgagtggcggggcgagggcgaggccccgcagagcctg
ctgaccatggaggagatccagtcggtggaggagacgcagatcaaggagcgcaagtgcctg
ctcctcaagatccgcggtgggaaacagttcattttgcagtgcgatagcgaccctgagctg
gtgcagtggaagaaggagctgcgcgacgcctaccgcgaggcccagcagctggtgcagcgg
gtgcccaagatgaagaacaagccgcgctcgcccgtggtggagctgagcaaggtgccgctg
gtccagcgcggcagtgccaacggcctctga

DBGET integrated database retrieval system