KEGG   Homo sapiens (human): 1562Help
Entry
1562              CDS       T01001                                 

Gene name
CYP2C18, CPCI, CYP2C, CYP2C17, P450-6B/29C, P450IIC17
Definition
cytochrome P450, family 2, subfamily C, polypeptide 18 (EC:1.14.14.1)
Orthology
K17720  
cytochrome P450, family 2, subfamily C, polypeptide 18 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1562 (CYP2C18)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    1562 (CYP2C18)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    1562 (CYP2C18)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1562 (CYP2C18)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1562 (CYP2C18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24
AA seq 490 aa AA seqDB search
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKV
YGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRW
KEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICS
VIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYI
KSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTE
TTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYID
LLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK
KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVP
PLYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccagctgtggctctggtgctctgtctctcctgtttgtttctcctttcactctgg
aggcagagctctggaagagggaggctcccgtctggccccactcctctcccgattattgga
aatatcctgcagttagatgttaaggacatgagcaaatccttaaccaatttctcaaaagtc
tatggccctgtgttcactgtgtattttggcctgaagcccattgtggtgttgcatggatat
gaagcagtgaaggaggccctgattgatcatggagaggagttttctggaagaggaagtttt
ccagtggctgaaaaagttaacaaaggacttggaatccttttcagcaatggaaagagatgg
aaggagatccggcgtttctgcctcatgactctgcggaattttgggatggggaagaggagc
atcgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaat
gcctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctct
gttattttccatgatcgatttgattataaagatcagaggtttcttaacttgatggaaaaa
ttcaatgaaaacctcaggattctgagctctccatggatccaggtctgcaataatttccct
gctctcatcgattatctcccaggaagtcataataaaatagctgaaaattttgcttacatt
aaaagttatgtattggagagaataaaagaacatcaagaatccctggacatgaacagtgct
cgggactttattgattgtttcctgatcaaaatggaacaggaaaagcacaatcaacagtct
gaatttactgttgaaagcttgatagccactgtaactgatatgtttggggctggaacagag
acaacgagcaccactctgagatatggactcctgctcctgctgaagtacccagaggtcaca
gctaaagtccaggaagagattgaatgtgtagttggcagaaaccggagcccctgtatgcag
gacaggagtcacatgccctacacagatgctgtggtgcacgagatccagagatacattgac
ctcctccccaccaacctgccccatgcagtgacctgtgatgttaaattcaaaaactacctc
atccccaagggcacgaccataataacatccctgacttctgtgctgcacaatgacaaagaa
ttccccaacccagagatgtttgaccctggccactttctggataagagtggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacggatgtgtatgggagagggcctg
gcccgcatggagctgtttttattcctgaccaccattttgcagaactttaacctgaaatct
caggttgacccaaaggatattgacatcacccccattgccaatgcatttggtcgtgtgcca
cccttgtaccagctctgcttcattcctgtctga

DBGET integrated database retrieval system