KEGG   Homo sapiens (human): 1562Help
Entry
1562              CDS       T01001                                 

Gene name
CYP2C18, CPCI, CYP2C, CYP2C17, P450-6B/29C, P450IIC17
Definition
cytochrome P450, family 2, subfamily C, polypeptide 18 (EC:1.14.14.1)
Orthology
K17720  
cytochrome P450, family 2, subfamily C, polypeptide 18 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Serotonergic synapse
Chemical carcinogenesis
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24
AA seq 490 aa AA seqDB search
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKV
YGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRW
KEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICS
VIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYI
KSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTE
TTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYID
LLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK
KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVP
PLYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccagctgtggctctggtgctctgtctctcctgtttgtttctcctttcactctgg
aggcagagctctggaagagggaggctcccgtctggccccactcctctcccgattattgga
aatatcctgcagttagatgttaaggacatgagcaaatccttaaccaatttctcaaaagtc
tatggccctgtgttcactgtgtattttggcctgaagcccattgtggtgttgcatggatat
gaagcagtgaaggaggccctgattgatcatggagaggagttttctggaagaggaagtttt
ccagtggctgaaaaagttaacaaaggacttggaatccttttcagcaatggaaagagatgg
aaggagatccggcgtttctgcctcatgactctgcggaattttgggatggggaagaggagc
atcgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaat
gcctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctct
gttattttccatgatcgatttgattataaagatcagaggtttcttaacttgatggaaaaa
ttcaatgaaaacctcaggattctgagctctccatggatccaggtctgcaataatttccct
gctctcatcgattatctcccaggaagtcataataaaatagctgaaaattttgcttacatt
aaaagttatgtattggagagaataaaagaacatcaagaatccctggacatgaacagtgct
cgggactttattgattgtttcctgatcaaaatggaacaggaaaagcacaatcaacagtct
gaatttactgttgaaagcttgatagccactgtaactgatatgtttggggctggaacagag
acaacgagcaccactctgagatatggactcctgctcctgctgaagtacccagaggtcaca
gctaaagtccaggaagagattgaatgtgtagttggcagaaaccggagcccctgtatgcag
gacaggagtcacatgccctacacagatgctgtggtgcacgagatccagagatacattgac
ctcctccccaccaacctgccccatgcagtgacctgtgatgttaaattcaaaaactacctc
atccccaagggcacgaccataataacatccctgacttctgtgctgcacaatgacaaagaa
ttccccaacccagagatgtttgaccctggccactttctggataagagtggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacggatgtgtatgggagagggcctg
gcccgcatggagctgtttttattcctgaccaccattttgcagaactttaacctgaaatct
caggttgacccaaaggatattgacatcacccccattgccaatgcatttggtcgtgtgcca
cccttgtaccagctctgcttcattcctgtctga

DBGET integrated database retrieval system