KEGG   Homo sapiens (human): 157Help
Entry
157               CDS       T01001                                 

Gene name
ADRBK2, BARK2, GRK3
Definition
adrenergic, beta, receptor kinase 2 (EC:2.7.11.15)
Orthology
K00910  
beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Endocytosis
Glutamatergic synapse
Olfactory transduction
Morphine addiction
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.1
AA seq 688 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFN
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
SHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNV
ELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRR
APKFLNKPRSGTVELPKPSLCHRNSNGL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggctgtgctggccgatgtcagttacctgatggccatggagaagagc
aaggcgaccccggccgcccgcgccagcaagaggatcgtcctgccggagcccagtatccgg
agtgtgatgcagaagtaccttgcagagagaaatgaaataacctttgacaagattttcaat
cagaaaattggtttcttgctatttaaagatttttgtttgaatgaaattaatgaagctgta
cctcaggtgaagttttatgaagagataaaggaatatgaaaaacttgataatgaggaagac
cgcctttgcagaagtcgacaaatttatgatgcctacatcatgaaggaacttctttcctgt
tcacatcctttctcaaagcaagctgtagaacacgtacaaagtcatttatccaagaaacaa
gtgacatcaactctttttcagccatacatagaagaaatttgtgaaagccttcgaggtgac
atttttcaaaaatttatggaaagtgacaagttcactagattttgtcagtggaaaaacgtt
gaattaaatatccatttgaccatgaatgagttcagtgtgcataggattattggacgagga
ggattcggggaagtttatggttgcaggaaagcagacactggaaaaatgtatgcaatgaaa
tgcttagataagaagaggatcaaaatgaaacaaggagaaacattagccttaaatgaaaga
atcatgttgtctcttgtcagcacaggagactgtcctttcattgtatgtatgacctatgcc
ttccataccccagataaactctgcttcatcctggatctgatgaacgggggcgatttgcac
taccacctttcacaacacggtgtgttctctgagaaggagatgcggttttatgccactgaa
atcattctgggtctggaacacatgcacaatcggtttgttgtctacagagatttgaagcca
gcaaatattctcttggatgaacatggacacgcaagaatatcagatcttggtcttgcctgc
gatttttccaaaaagaagcctcatgcgagtgttggcacccatgggtacatggctcccgag
gtgctgcagaaggggacggcctatgacagcagtgccgactggttctccctgggctgcatg
cttttcaaacttctgagaggtcacagccctttcagacaacataaaaccaaagacaagcat
gaaattgaccgaatgacactcaccgtgaatgtggaacttccagacaccttctctcctgaa
ctgaagtcccttttggagggcttgcttcagcgagacgttagcaagcggctgggctgtcac
ggaggcggctcacaggaagtaaaagagcacagctttttcaaaggtgttgactggcagcat
gtctacttacaaaagtacccaccacccttgattcctccccggggagaagtcaatgctgct
gatgcctttgatattggctcatttgatgaagaggataccaaagggattaagctacttgat
tgcgaccaagaactctacaagaacttccctttggtcatctctgaacgctggcagcaagaa
gtaacggaaacagtttatgaagcagtaaatgcagacacagataaaatcgaggccaggaag
agagctaaaaataagcaacttggccacgaagaagattacgctctggggaaggactgtatt
atgcacgggtacatgctgaaactgggaaacccatttctgactcagtggcagcgtcgctat
ttttacctctttccaaatagacttgaatggagaggagagggagagtcccggcaaaattta
ctgacaatggaacagattctctctgtggaagaaactcaaattaaagacaaaaaatgcatt
ttgttcagaataaaaggagggaaacaatttgtcttgcaatgtgagagtgatccagagttt
gtgcagtggaagaaagagttgaacgaaaccttcaaggaggcccagcggctattgcgtcgt
gccccgaagttcctcaacaaacctcggtcaggtactgtggagctcccaaagccatccctc
tgtcacagaaacagcaacggcctctag

DBGET integrated database retrieval system