KEGG   Homo sapiens (human): 157Help
Entry
157               CDS       T01001                                 

Gene name
ADRBK2, BARK2, GRK3
Definition
adrenergic, beta, receptor kinase 2 (EC:2.7.11.15)
Orthology
K00910  
beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Endocytosis
Glutamatergic synapse
Olfactory transduction
Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    157 (ADRBK2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    157 (ADRBK2)
  Nervous system
   04724 Glutamatergic synapse
    157 (ADRBK2)
  Sensory system
   04740 Olfactory transduction
    157 (ADRBK2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    157 (ADRBK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     157 (ADRBK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  GRK family [OT]
   157 (ADRBK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   157 (ADRBK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.1
AA seq 688 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFN
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
SHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNV
ELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRR
APKFLNKPRSGTVELPKPSLCHRNSNGL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggctgtgctggccgatgtcagttacctgatggccatggagaagagc
aaggcgaccccggccgcccgcgccagcaagaggatcgtcctgccggagcccagtatccgg
agtgtgatgcagaagtaccttgcagagagaaatgaaataacctttgacaagattttcaat
cagaaaattggtttcttgctatttaaagatttttgtttgaatgaaattaatgaagctgta
cctcaggtgaagttttatgaagagataaaggaatatgaaaaacttgataatgaggaagac
cgcctttgcagaagtcgacaaatttatgatgcctacatcatgaaggaacttctttcctgt
tcacatcctttctcaaagcaagctgtagaacacgtacaaagtcatttatccaagaaacaa
gtgacatcaactctttttcagccatacatagaagaaatttgtgaaagccttcgaggtgac
atttttcaaaaatttatggaaagtgacaagttcactagattttgtcagtggaaaaacgtt
gaattaaatatccatttgaccatgaatgagttcagtgtgcataggattattggacgagga
ggattcggggaagtttatggttgcaggaaagcagacactggaaaaatgtatgcaatgaaa
tgcttagataagaagaggatcaaaatgaaacaaggagaaacattagccttaaatgaaaga
atcatgttgtctcttgtcagcacaggagactgtcctttcattgtatgtatgacctatgcc
ttccataccccagataaactctgcttcatcctggatctgatgaacgggggcgatttgcac
taccacctttcacaacacggtgtgttctctgagaaggagatgcggttttatgccactgaa
atcattctgggtctggaacacatgcacaatcggtttgttgtctacagagatttgaagcca
gcaaatattctcttggatgaacatggacacgcaagaatatcagatcttggtcttgcctgc
gatttttccaaaaagaagcctcatgcgagtgttggcacccatgggtacatggctcccgag
gtgctgcagaaggggacggcctatgacagcagtgccgactggttctccctgggctgcatg
cttttcaaacttctgagaggtcacagccctttcagacaacataaaaccaaagacaagcat
gaaattgaccgaatgacactcaccgtgaatgtggaacttccagacaccttctctcctgaa
ctgaagtcccttttggagggcttgcttcagcgagacgttagcaagcggctgggctgtcac
ggaggcggctcacaggaagtaaaagagcacagctttttcaaaggtgttgactggcagcat
gtctacttacaaaagtacccaccacccttgattcctccccggggagaagtcaatgctgct
gatgcctttgatattggctcatttgatgaagaggataccaaagggattaagctacttgat
tgcgaccaagaactctacaagaacttccctttggtcatctctgaacgctggcagcaagaa
gtaacggaaacagtttatgaagcagtaaatgcagacacagataaaatcgaggccaggaag
agagctaaaaataagcaacttggccacgaagaagattacgctctggggaaggactgtatt
atgcacgggtacatgctgaaactgggaaacccatttctgactcagtggcagcgtcgctat
ttttacctctttccaaatagacttgaatggagaggagagggagagtcccggcaaaattta
ctgacaatggaacagattctctctgtggaagaaactcaaattaaagacaaaaaatgcatt
ttgttcagaataaaaggagggaaacaatttgtcttgcaatgtgagagtgatccagagttt
gtgcagtggaagaaagagttgaacgaaaccttcaaggaggcccagcggctattgcgtcgt
gccccgaagttcctcaacaaacctcggtcaggtactgtggagctcccaaagccatccctc
tgtcacagaaacagcaacggcctctag

DBGET integrated database retrieval system