KEGG   Homo sapiens (human): 1572Help
Entry
1572              CDS       T01001                                 

Gene name
CYP2F1, C2F1, CYP2F
Definition
cytochrome P450, family 2, subfamily F, polypeptide 1 (EC:1.14.14.1)
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1572 (CYP2F1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1572 (CYP2F1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1572 (CYP2F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 491 aa AA seqDB search
MDSISTAILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLLLLCSQDMLTSLTKLSK
EYGSMYTVHLGPRRVVVLSGYQAVKEALVDQGEEFSGRGDYPAFFNFTKGNGIAFSSGDR
WKVLRQFSIQILRNFGMGKRSIEERILEEGSFLLAELRKTEGEPFDPTFVLSRSVSNIIC
SVLFGSRFDYDDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKC
LRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLMTTHNLLFGGT
KTVSTTLHHAFLALMKYPKVQARVQEEIDLVVGRARLPALKDRAAMPYTDAVIHEVQRFA
DIIPMNLPHRVTRDTAFRGFLIPKGTDVITLLNTVHYDPSQFLTPQEFNPEHFLDANQSF
KKSPAFMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPLSSGLGNL
PRPFQLCLRPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggacagcataagcacagccatcttactcctgctcctggctctcgtctgtctgctcctg
accctaagctcaagagataagggaaagctgcctccgggacccagacccctctcaatcctg
ggaaacctgctgctgctttgctcccaagacatgctgacttctctcactaagctgagcaag
gagtatggctccatgtacacagtgcacctgggacccaggcgggtggtggtcctcagcggg
taccaagctgtgaaggaggccctggtggaccagggagaggagtttagtggccgcggtgac
taccctgcctttttcaactttaccaagggcaatggcatcgccttctccagtggggatcga
tggaaggtcctgagacagttctctatccagattctacggaatttcgggatggggaagaga
agcattgaggagcgaatcctagaggagggcagcttcctgctggcggagctgcggaaaact
gaaggcgagccctttgaccccacgtttgtgctgagtcgctcagtgtccaacattatctgt
tccgtgctcttcggcagccgcttcgactatgatgatgagcgtctgctcaccattatccgc
cttatcaatgacaacttccaaatcatgagcagcccctggggcgagttgtacgacatcttc
ccgagcctcctggactgggtgcctgggccgcaccaacgcatcttccagaacttcaagtgc
ctgagagacctcatcgcccacagcgtccacgaccaccaggcctcgctagaccccagatct
ccccgggacttcatccagtgcttcctcaccaagatggcagaggagaaggaggacccactg
agccacttccacatggataccctgctgatgaccacacataacctgctctttggcggcacc
aagacggtgagcaccacgctgcaccacgccttcctggcactcatgaagtacccaaaagtt
caagcccgcgtgcaggaggagatcgacctcgtggtgggacgcgcgcggctgccggcgctg
aaggaccgcgcggccatgccttacacagacgcggtgatccacgaggtgcagcgctttgca
gacatcatccccatgaacttgccgcaccgcgtcactagggacacggcctttcgcggcttc
ctgatacccaagggcaccgatgtcatcaccctccttaacaccgtccactacgaccccagc
cagttcctgacgccccaggagttcaaccccgagcattttttggatgccaatcagtccttc
aagaagagtccagccttcatgcccttctcagctgggcgccgtctgtgcctgggagagtcg
ctggcgcgcatggagctctttctgtacctcaccgccatcctgcagagcttttcgctgcag
ccgctgggtgcgcccgaggacatcgacctgaccccactcagctcaggtcttggcaatttg
ccgcggcctttccagctgtgcctgcgcccgcgctaa

DBGET integrated database retrieval system