KEGG   Homo sapiens (human): 1572Help
Entry
1572              CDS       T01001                                 

Gene name
CYP2F1, C2F1, CYP2F
Definition
cytochrome P450, family 2, subfamily F, polypeptide 1 (EC:1.14.14.1)
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:hsa00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 491 aa AA seqDB search
MDSISTAILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLLLLCSQDMLTSLTKLSK
EYGSMYTVHLGPRRVVVLSGYQAVKEALVDQGEEFSGRGDYPAFFNFTKGNGIAFSSGDR
WKVLRQFSIQILRNFGMGKRSIEERILEEGSFLLAELRKTEGEPFDPTFVLSRSVSNIIC
SVLFGSRFDYDDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKC
LRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLMTTHNLLFGGT
KTVSTTLHHAFLALMKYPKVQARVQEEIDLVVGRARLPALKDRAAMPYTDAVIHEVQRFA
DIIPMNLPHRVTRDTAFRGFLIPKGTDVITLLNTVHYDPSQFLTPQEFNPEHFLDANQSF
KKSPAFMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPLSSGLGNL
PRPFQLCLRPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggacagcataagcacagccatcttactcctgctcctggctctcgtctgtctgctcctg
accctaagctcaagagataagggaaagctgcctccgggacccagacccctctcaatcctg
ggaaacctgctgctgctttgctcccaagacatgctgacttctctcactaagctgagcaag
gagtatggctccatgtacacagtgcacctgggacccaggcgggtggtggtcctcagcggg
taccaagctgtgaaggaggccctggtggaccagggagaggagtttagtggccgcggtgac
taccctgcctttttcaactttaccaagggcaatggcatcgccttctccagtggggatcga
tggaaggtcctgagacagttctctatccagattctacggaatttcgggatggggaagaga
agcattgaggagcgaatcctagaggagggcagcttcctgctggcggagctgcggaaaact
gaaggcgagccctttgaccccacgtttgtgctgagtcgctcagtgtccaacattatctgt
tccgtgctcttcggcagccgcttcgactatgatgatgagcgtctgctcaccattatccgc
cttatcaatgacaacttccaaatcatgagcagcccctggggcgagttgtacgacatcttc
ccgagcctcctggactgggtgcctgggccgcaccaacgcatcttccagaacttcaagtgc
ctgagagacctcatcgcccacagcgtccacgaccaccaggcctcgctagaccccagatct
ccccgggacttcatccagtgcttcctcaccaagatggcagaggagaaggaggacccactg
agccacttccacatggataccctgctgatgaccacacataacctgctctttggcggcacc
aagacggtgagcaccacgctgcaccacgccttcctggcactcatgaagtacccaaaagtt
caagcccgcgtgcaggaggagatcgacctcgtggtgggacgcgcgcggctgccggcgctg
aaggaccgcgcggccatgccttacacagacgcggtgatccacgaggtgcagcgctttgca
gacatcatccccatgaacttgccgcaccgcgtcactagggacacggcctttcgcggcttc
ctgatacccaagggcaccgatgtcatcaccctccttaacaccgtccactacgaccccagc
cagttcctgacgccccaggagttcaaccccgagcattttttggatgccaatcagtccttc
aagaagagtccagccttcatgcccttctcagctgggcgccgtctgtgcctgggagagtcg
ctggcgcgcatggagctctttctgtacctcaccgccatcctgcagagcttttcgctgcag
ccgctgggtgcgcccgaggacatcgacctgaccccactcagctcaggtcttggcaatttg
ccgcggcctttccagctgtgcctgcgcccgcgctaa

DBGET integrated database retrieval system