KEGG   Homo sapiens (human): 1573Help
Entry
1573              CDS       T01001                                 

Gene name
CYP2J2, CPJ2
Definition
cytochrome P450, family 2, subfamily J, polypeptide 2 (EC:1.14.14.1)
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    1573 (CYP2J2)
   00591 Linoleic acid metabolism
    1573 (CYP2J2)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    1573 (CYP2J2)
  Nervous system
   04726 Serotonergic synapse
    1573 (CYP2J2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1573 (CYP2J2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1573 (CYP2J2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1573 (CYP2J2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.3-p31.2
AA seq 502 aa AA seqDB search
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD
FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI
FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP
HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL
PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS
LKFRMGITISPVSHRLCAVPQV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggcgatgggctctctggcggctgccctctgggcagtggtccatcctcggact
ctcctactgggcactgtcgcctttctgctcgctgctgactttctcaaaagacggcgccca
aagaactacccgccggggccctggcgcctgcccttccttggcaacttcttccttgtggac
ttcgagcagtcgcacctggaggttcagctgtttgtgaagaaatatgggaacctttttagc
ttggagcttggtgacatatctgcagttcttattactggcttgcccttaatcaaagaagcc
cttatccacatggaccaaaactttgggaaccgccccgtgacccctatgcgagaacatatc
tttaagaaaaatggattgattatgtcaagtggccaggcatggaaggagcaaagaaggttc
actctgacagcactaaggaactttggtttaggaaagaagagcttagaggaacgcattcag
gaggaggcccaacacctcactgaagcaataaaagaggagaacggacagccttttgaccct
catttcaagatcaacaatgcagtttccaatatcatttgctccatcaccttcggagaacgc
tttgagtaccaggatagttggtttcagcagctgctgaagttactagatgaagtcacatac
ttggaggcttcaaagacatgccagctctacaatgtctttccatggataatgaaattcctg
cctggaccccaccaaactctcttcagcaactggaaaaaactgaaattgtttgtttctcat
atgattgacaaacacagaaaggattggaatcctgcagaaacaagagactttattgatgct
taccttaaagaaatgtcaaagcacacaggcaatcctacttcaagtttccatgaagaaaac
ctcatctgcagcaccctggacctcttctttgccggaaccgagacaacttccacaactctg
cgatgggctctgctttatatggccctctacccagaaatccaagaaaaagtacaagctgag
attgacagagtgattggccaggggcagcagccgagcacagccgcccgggagtccatgccc
tacaccaatgctgtcatccatgaggtgcagagaatgggcaacatcatccccctgaacgtt
cccagggaagtgacagttgataccactttggctgggtaccacctgcccaagggtaccatg
atcctgaccaatttgacggcgctgcacagggaccccacagagtgggccacccctgacaca
ttcaatccggaccattttctggagaatggacagtttaagaaaagggaagcctttatgcct
ttctcaataggaaagcgggcatgcctcggagaacagttggccaggactgagctgtttatt
ttcttcacttcccttatgcaaaaatttaccttcaggcccccaaacaatgagaagctgagc
ctgaagtttagaatgggtatcaccatttccccagtcagtcaccgcctctgcgctgttcct
caggtgtaa

DBGET integrated database retrieval system