KEGG   Homo sapiens (human): 1573Help
Entry
1573              CDS       T01001                                 

Gene name
CYP2J2, CPJ2
Definition
cytochrome P450, family 2, subfamily J, polypeptide 2 (EC:1.14.14.1)
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.3-p31.2
AA seq 502 aa AA seqDB search
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD
FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI
FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP
HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL
PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS
LKFRMGITISPVSHRLCAVPQV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggcgatgggctctctggcggctgccctctgggcagtggtccatcctcggact
ctcctactgggcactgtcgcctttctgctcgctgctgactttctcaaaagacggcgccca
aagaactacccgccggggccctggcgcctgcccttccttggcaacttcttccttgtggac
ttcgagcagtcgcacctggaggttcagctgtttgtgaagaaatatgggaacctttttagc
ttggagcttggtgacatatctgcagttcttattactggcttgcccttaatcaaagaagcc
cttatccacatggaccaaaactttgggaaccgccccgtgacccctatgcgagaacatatc
tttaagaaaaatggattgattatgtcaagtggccaggcatggaaggagcaaagaaggttc
actctgacagcactaaggaactttggtttaggaaagaagagcttagaggaacgcattcag
gaggaggcccaacacctcactgaagcaataaaagaggagaacggacagccttttgaccct
catttcaagatcaacaatgcagtttccaatatcatttgctccatcaccttcggagaacgc
tttgagtaccaggatagttggtttcagcagctgctgaagttactagatgaagtcacatac
ttggaggcttcaaagacatgccagctctacaatgtctttccatggataatgaaattcctg
cctggaccccaccaaactctcttcagcaactggaaaaaactgaaattgtttgtttctcat
atgattgacaaacacagaaaggattggaatcctgcagaaacaagagactttattgatgct
taccttaaagaaatgtcaaagcacacaggcaatcctacttcaagtttccatgaagaaaac
ctcatctgcagcaccctggacctcttctttgccggaaccgagacaacttccacaactctg
cgatgggctctgctttatatggccctctacccagaaatccaagaaaaagtacaagctgag
attgacagagtgattggccaggggcagcagccgagcacagccgcccgggagtccatgccc
tacaccaatgctgtcatccatgaggtgcagagaatgggcaacatcatccccctgaacgtt
cccagggaagtgacagttgataccactttggctgggtaccacctgcccaagggtaccatg
atcctgaccaatttgacggcgctgcacagggaccccacagagtgggccacccctgacaca
ttcaatccggaccattttctggagaatggacagtttaagaaaagggaagcctttatgcct
ttctcaataggaaagcgggcatgcctcggagaacagttggccaggactgagctgtttatt
ttcttcacttcccttatgcaaaaatttaccttcaggcccccaaacaatgagaagctgagc
ctgaagtttagaatgggtatcaccatttccccagtcagtcaccgcctctgcgctgttcct
caggtgtaa

DBGET integrated database retrieval system