KEGG   Homo sapiens (human): 157855Help
Entry
157855            CDS       T01001                                 

Gene name
KCNU1, KCNMC1, KCa5, KCa5.1, Kcnma3, Slo3
Definition
potassium channel, subfamily U, member 1
Orthology
K05274  
potassium large conductance calcium-activated channel subfamily M alpha member 3
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    157855 (KCNU1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    157855 (KCNU1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    157855 (KCNU1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   157855 (KCNU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p11.23
AA seq 1149 aa AA seqDB search
MFQTKLRNETWEDLPKMSCTTEIQAAFILSSFVTFFSGLIILLIFRLIWRSVKKWQIIKG
TGIILELFTSGTIARSHVRSLHFQGQFRDHIEMLLSAQTFVGQVLVILVFVLSIGSLIIY
FINSADPVGSCSSYEDKTIPIDLVFNAFFSFYFGLRFMAADDKIKFWLEMNSIVDIFTIP
PTFISYYLKSNWLGLRFLRALRLLELPQILQILRAIKTSNSVKFSKLLSIILSTWFTAAG
FIHLVENSGDPWLKGRNSQNISYFESIYLVMATTSTVGFGDVVAKTSLGRTFIMFFTLGS
LILFANYIPEMVELFANKRKYTSSYEALKGKKFIVVCGNITVDSVTAFLRNFLRDKSGEI
NTEIVFLGETPPSLELETIFKCYLAYTTFISGSAMKWEDLRRVAVESAEACLIIANPLCS
DSHAEDISNIMRVLSIKNYDSTTRIIIQILQSHNKVYLPKIPSWNWDTGDNIICFAELKL
GFIAQGCLVPGLCTFLTSLFVEQNKKVMPKQTWKKHFLNSMKNKILTQRLSDDFAGMSFP
EVARLCFLKMHLLLIAIEYKSLFTDGFCGLILNPPPQVRIRKNTLGFFIAETPKDVRRAL
FYCSVCHDDVFIPELITNCGCKSRSRQHITVPSVKRMKKCLKGISSRISGQDSPPRVSAS
TSSISNFTTRTLQHDVEQDSDQLDSSGMFHWCKPTSLDKVTLKRTGKSKYKFRNHIVACV
FGDAHSAPMGLRNFVMPLRASNYTRKELKDIVFIGSLDYLQREWRFLWNFPQIYILPGCA
LYSGDLHAANIEQCSMCAVLSPPPQPSSNQTLVDTEAIMATLTIGSLQIDSSSDPSPSVS
EETPGYTNGHNEKSNCRKVPILTELKNPSNIHFIEQLGGLEGSLQETNLHLSTAFSTGTV
FSGSFLDSLLATAFYNYHVLELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNR
CKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITR
PANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDS
VTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDE
DPFAYSEPL
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagactaagctacgaaatgaaacttgggaagacttgccaaaaatgtcctgcaca
actgagatccaagcagcattcattctctcttcctttgtgaccttcttcagtggactcatc
atcctgttgatcttcaggctgatctggagatctgttaaaaaatggcaaatcatcaaggga
acaggaattatcttggaactgttcacatcaggtaccatcgctaggagccatgtaagaagc
ctccacttccagggacaatttcgtgatcatatagaaatgttgctttcagcccagaccttt
gtggggcaagtgttggtgatccttgtctttgtactaagcattgggtctcttataatctat
ttcatcaattctgctgaccctgttggaagctgttcatcatatgaagacaaaaccattcct
attgatttggttttcaatgctttctttagtttctattttggattgaggtttatggcagct
gatgacaagatcaagttctggctggagatgaattcaatcgtagacatctttaccatccca
ccaacctttatttcttattatttgaagagcaattggctaggtttaaggttcctaagagcc
ttgcgcctgctagaactccctcaaatcttgcaaattctacgagccatcaagaccagtaac
tcagtgaagttttccaaactgctgtcaataattctcagtacctggttcacagctgcggga
ttcattcacctggtggaaaattctggtgatccctggctcaaaggtagaaattcacagaat
atatcatattttgagtcaatttacctggtcatggcaacaacgtcaaccgttggatttgga
gatgtggtagccaagacatccttaggacggaccttcatcatgttcttcacactggggagt
ttgatattatttgcgaactatatacctgaaatggtggaactgtttgctaacaagaggaaa
tacaccagttcctatgaagcactcaaaggaaagaagtttattgtggtctgtggaaacatc
actgtggacagtgtgaccgctttcctgaggaatttcctccgcgacaagtcaggagagatc
aacactgaaattgttttcctgggagaaacccctccttctttggaacttgaaaccatattt
aaatgctacttggcctacacaacgttcatttctggatctgcaatgaagtgggaggatctg
aggcgagttgcggtggaatctgcagaggcatgcctgattatagccaatcctttgtgcagt
gattcccatgctgaagatatttccaacattatgagggtgctctctatcaagaactatgat
tctaccaccagaatcatcatacagatactgcaatcccataacaaggtttatctgccaaag
attcccagctggaactgggacaccggagacaacatcatctgctttgctgaattaaaactt
ggatttatcgcccaaggctgtttggtgccaggcttgtgtaccttcctaacatctctattt
gtggagcaaaacaaaaaggttatgcctaaacagacctggaagaaacacttcttgaatagc
atgaaaaacaaaattctgacccaacgtctctctgatgactttgctggaatgagctttcct
gaagttgcccggctctgctttctgaagatgcacctcctgttgatagccatcgaatacaag
tccctctttacggatggtttctgtggtctgatactaaatccacctccacaagtgaggata
cgtaagaacacattagggttctttattgctgaaactccaaaggacgtcagaagagccttg
ttttactgttcagtctgtcatgatgatgtgttcattcctgagctaattacaaactgtggc
tgcaaaagcagaagccggcagcacatcacagtgccatcggtaaagagaatgaaaaaatgt
ctgaagggaatctcctctcgtatatcagggcaggattctccgccaagggtatctgcaagc
acttcgagcatatcaaacttcaccaccaggactcttcaacatgatgtagaacaagattct
gaccagcttgatagcagtgggatgtttcactggtgcaaaccaacctctttggacaaggtg
actctgaaacgaactggcaagtcaaagtataagtttcggaaccatattgtagcatgtgta
tttggagatgcccactcagccccgatggggcttcggaactttgtaatgcccttgagagcc
agcaactataccaggaaggagctgaaggacatagtgttcattgggtctctggactatcta
cagagagaatggcgatttctctggaattttccccagatatacattctgcctggatgtgca
ctttattctggagacctccatgcggccaacatagagcaatgctccatgtgtgctgtcttg
tcccccccaccccagccatcaagcaaccagactttggtagacacagaagccatcatggca
accctcaccatcggatccttgcaaattgactcctcctctgacccgtcaccctcagtgtca
gaggagactccaggttacacaaatggacataatgagaaatcaaactgccgaaaagtccct
atccttactgaactgaaaaatccttccaacattcactttattgaacagcttggtggactg
gaagggtccctccaagaaacaaatctgcatctcagcactgccttttctacgggcactgtt
ttttccggcagcttcttggattctctgctggccacggccttctacaattatcatgtcctg
gaattgcttcagatgctggtgacaggaggagtaagttctcagctggaacaacatttagat
aaggataaagtctatggtgtggcagatagctgcacgtcgctcttgtctggaagaaaccgg
tgtaagctggggcttctgtccttacacgaaaccattttatcagacgttaatccaagaaac
acctttggacaactgttctgtggctcattagatctttttggaatcctgtgtgttggctta
taccgaataattgatgaagaggagctcaacccagaaaacaaaaggtttgtgatcacccgg
ccagccaatgagttcaagctgctgccttcagatcttgtgttttgtgccatacccttcagc
actgcttgttataaaaggaatgaagagttctcattgcaaaagtcatatgaaattgtaaat
aaagcatcacagacaacagagacacattcagacacaaattgtcctcccaccattgattca
gttactgagacattgtattcaccagtctattcttaccagccgagaactaactccctctct
tttcctaagcaaatagcatggaatcagagtagaacaaacagtattatatcatctcagata
cctttaggtgacaatgcaaaagaaaatgaaaggaaaacttcagatgaggtttatgatgag
gatccctttgcatattcagagccactatag

DBGET integrated database retrieval system