KEGG   Homo sapiens (human): 1579Help
Entry
1579              CDS       T01001                                 

Gene name
CYP4A11, CP4Y, CYP4A2, CYP4AII
Definition
cytochrome P450, family 4, subfamily A, polypeptide 11 (EC:1.14.15.3)
Orthology
K17687  
alkane 1-monooxygenase [EC:1.14.15.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Vascular smooth muscle contraction
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33
AA seq 519 aa AA seqDB search
MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLF
GHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL
LPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctctgtgctgagccccagcagactcctgggtgatgtctctggaatcctccaa
gcggcctccctgctcattctgcttctgctgctgatcaaggcagttcagctctacctgcac
aggcagtggctgctcaaagccctccagcagttcccgtgccctccctcccactggctcttc
gggcacatccaggagctccaacaggaccaggagctacaacggattcagaaatgggtggag
acattcccaagtgcctgtcctcattggctatggggaggcaaagttcgtgtccagctctat
gaccctgactatatgaaggtgattctggggagatcagacccgaaatcccatggttcctac
agattcctggctccatggattgggtacggcttgctcctgttgaatgggcagacatggttc
cagcatcgacggatgctgaccccagccttccactatgacatcctgaagccctatgtgggg
ctcatggcagactctgtacgagtgatgctggacaaatgggaagagctccttggccaggat
tcccctctggaggtctttcagcacgtctccttgatgaccctggacaccatcatgaagtgt
gccttcagccatcagggcagcatccaggtggacaggaattctcagtcctacatacaggcc
attagtgacctgaacaacctggttttttcccgtgtgaggaatgcctttcaccagaatgac
accatctacagcctgacctctgctggccgctggacacaccgcgcctgccagctggcccat
cagcacacagaccaagtgatccaactgaggaaggctcaactacagaaggagggggagctg
gagaagatcaagaggaagaggcatttggattttctggatatcctcctcttggccaaaatg
gagaatgggagcatcttgtcagacaaggacctccgtgctgaggtggacacgttcatgttt
gagggccacgacaccacagccagtgggatctcctggatcctctatgctctggccacacac
cccaagcatcaggagaggtgccgggaggagatccacagcctcctgggtgatggagcctcc
atcacctggaaccacctggaccagatgccctacaccaccatgtgcattaaggaggcactg
aggctctacccaccggtgccaggcattggcagagagctcagcactcccgtcaccttccct
gatgggcgctccttgcccaaaggtatcatggtcctcctctccatttatggccttcaccac
aacccaaaagtgtggcccaacccagaggtgtttgaccctttccgttttgcaccgggttct
gctcaacacagccacgctttcctgcccttctcaggaggatcaaggaactgcatcgggaaa
caatttgccatgaacgagctgaaggtggccacggccctgaccctgctccgctttgagctg
ctgcctgatcccaccaggatccccatccccattgcacgacttgtgttgaaatccaaaaat
ggaatccacctgcgtctcaggaggctccctaacccttgtgaagacaaggaccagctttga

DBGET integrated database retrieval system