KEGG   Homo sapiens (human): 1579Help
Entry
1579              CDS       T01001                                 

Gene name
CYP4A11, CP4Y, CYP4A2, CYP4AII
Definition
cytochrome P450, family 4, subfamily A, polypeptide 11 (EC:1.14.15.3)
Orthology
K17687  
alkane 1-monooxygenase [EC:1.14.15.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    1579 (CYP4A11)
   00590 Arachidonic acid metabolism
    1579 (CYP4A11)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1579 (CYP4A11)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    1579 (CYP4A11)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.3  alkane 1-monooxygenase
     1579 (CYP4A11)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   1579 (CYP4A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33
AA seq 519 aa AA seqDB search
MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLF
GHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL
LPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctctgtgctgagccccagcagactcctgggtgatgtctctggaatcctccaa
gcggcctccctgctcattctgcttctgctgctgatcaaggcagttcagctctacctgcac
aggcagtggctgctcaaagccctccagcagttcccgtgccctccctcccactggctcttc
gggcacatccaggagctccaacaggaccaggagctacaacggattcagaaatgggtggag
acattcccaagtgcctgtcctcattggctatggggaggcaaagttcgtgtccagctctat
gaccctgactatatgaaggtgattctggggagatcagacccgaaatcccatggttcctac
agattcctggctccatggattgggtacggcttgctcctgttgaatgggcagacatggttc
cagcatcgacggatgctgaccccagccttccactatgacatcctgaagccctatgtgggg
ctcatggcagactctgtacgagtgatgctggacaaatgggaagagctccttggccaggat
tcccctctggaggtctttcagcacgtctccttgatgaccctggacaccatcatgaagtgt
gccttcagccatcagggcagcatccaggtggacaggaattctcagtcctacatacaggcc
attagtgacctgaacaacctggttttttcccgtgtgaggaatgcctttcaccagaatgac
accatctacagcctgacctctgctggccgctggacacaccgcgcctgccagctggcccat
cagcacacagaccaagtgatccaactgaggaaggctcaactacagaaggagggggagctg
gagaagatcaagaggaagaggcatttggattttctggatatcctcctcttggccaaaatg
gagaatgggagcatcttgtcagacaaggacctccgtgctgaggtggacacgttcatgttt
gagggccacgacaccacagccagtgggatctcctggatcctctatgctctggccacacac
cccaagcatcaggagaggtgccgggaggagatccacagcctcctgggtgatggagcctcc
atcacctggaaccacctggaccagatgccctacaccaccatgtgcattaaggaggcactg
aggctctacccaccggtgccaggcattggcagagagctcagcactcccgtcaccttccct
gatgggcgctccttgcccaaaggtatcatggtcctcctctccatttatggccttcaccac
aacccaaaagtgtggcccaacccagaggtgtttgaccctttccgttttgcaccgggttct
gctcaacacagccacgctttcctgcccttctcaggaggatcaaggaactgcatcgggaaa
caatttgccatgaacgagctgaaggtggccacggccctgaccctgctccgctttgagctg
ctgcctgatcccaccaggatccccatccccattgcacgacttgtgttgaaatccaaaaat
ggaatccacctgcgtctcaggaggctccctaacccttgtgaagacaaggaccagctttga

DBGET integrated database retrieval system