KEGG   Homo sapiens (human): 158Help
Entry
158               CDS       T01001                                 

Gene name
ADSL, AMPS, ASASE, ASL
Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Disease
H00197  Adenylosuccinate lyase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    158 (ADSL)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    158 (ADSL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     158 (ADSL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 ADSL_C DUF4089 HTH_Tnp_Tc5 DUF1331
Motif
Other DBs
NCBI-GeneID: 158
NCBI-ProteinID: NP_000017
OMIM: 608222
HGNC: 291
Ensembl: ENSG00000239900
Vega: OTTHUMG00000166425
Pharos: P30566(Tbio)
UniProt: P30566 X5D8S6
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 484 aa AA seqDB search
MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDE
QIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTD
LIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLC
MDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITG
QTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR
SERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISE
GLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGD
NDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA
ELCL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcggctggaggcgatcatggttcgcccgacagctaccgctcacctcttgcctcccgc
tatgccagcccggagatgtgcttcgtgtttagcgacaggtataaattccggacatggcgg
cagctgtggctgtggctggcggaggccgagcagacattgggtttgcctatcacagatgaa
caaatccaggagatgaaatcaaacctggagaacatcgacttcaagatggcagctgaggaa
gagaaacgtttacgacatgatgtgatggctcacgtgcacacatttggccactgctgtcca
aaagctgcaggcattattcaccttggtgctacttcttgctatgttggagacaatactgac
ttgattattcttagaaatgcacttgacctgcttttgccaaagcttgccagagtgatctct
cggcttgccgactttgctaaggaacgagccagtctacccacattaggtttcacacatttc
cagcctgcacagctgaccacagttgggaaacgttgctgtctttggattcaggatctttgc
atggatctccagaacttgaagcgtgtccgagatgacctgcgcttccggggagtaaagggt
accactggcactcaggccagtttcctgcagctctttgagggagatgaccataaggtagag
cagcttgacaagatggtgacagaaaaggcaggatttaagagagctttcatcatcacaggg
cagacatatacacgaaaagtggatattgaagtactgtctgtgctggctagcttgggggca
tcagtgcacaagatttgcaccgacatacgcctcctggcaaacctcaaggagatggaggaa
ccctttgaaaaacagcagattggctcaagtgcgatgccatataagcggaatcccatgcgt
tcagaacgttgctgcagtcttgcccgccacctgatgacccttgtcatggacccgctacag
acagcatctgtccagtggtttgaacgcacactggatgatagtgccaaccgacggatctgt
ttggccgaggcatttcttaccgcagatactatattgaatacgctgcagaacatttctgaa
ggattggtcgtgtaccccaaagtaattgaacggcgcattcggcaagagctgcctttcatg
gccacagagaacatcatcatggccatggtcaaagctggaggtagccgccaggattgccat
gagaaaatcagagtgctttctcagcaggcagcttctgtggttaagcaggaagggggtgac
aatgacctcatagagcgtatccaggttgatgcctacttcagtcccattcactcccagttg
gatcatttactggatccttcttctttcactggtcgtgcctcccagcaggtgcagagattc
ttagaagaggaggtgtatcccctgttaaaaccatatgaaagcgtgatgaaggtgaaagca
gaattatgtctgtag

DBGET integrated database retrieval system