KEGG   Homo sapiens (human): 158Help
Entry
158               CDS       T01001                                 

Gene name
ADSL, AMPS, ASASE, ASL
Definition
adenylosuccinate lyase (EC:4.3.2.2)
Orthology
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Disease
H00197  
Adenylosuccinate lyase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    158 (ADSL)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    158 (ADSL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     158 (ADSL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 484 aa AA seqDB search
MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDE
QIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTD
LIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLC
MDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITG
QTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR
SERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISE
GLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGD
NDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA
ELCL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcggctggaggcgatcatggttcgcccgacagctaccgctcacctcttgcctcccgc
tatgccagcccggagatgtgcttcgtgtttagcgacaggtataaattccggacatggcgg
cagctgtggctgtggctggcggaggccgagcagacattgggtttgcctatcacagatgaa
caaatccaggagatgaaatcaaacctggagaacatcgacttcaagatggcagctgaggaa
gagaaacgtttacgacatgatgtgatggctcacgtgcacacatttggccactgctgtcca
aaagctgcaggcattattcaccttggtgctacttcttgctatgttggagacaatactgac
ttgattattcttagaaatgcacttgacctgcttttgccaaagcttgccagagtgatctct
cggcttgccgactttgctaaggaacgagccagtctacccacattaggtttcacacatttc
cagcctgcacagctgaccacagttgggaaacgttgctgtctttggattcaggatctttgc
atggatctccagaacttgaagcgtgtccgagatgacctgcgcttccggggagtaaagggt
accactggcactcaggccagtttcctgcagctctttgagggagatgaccataaggtagag
cagcttgacaagatggtgacagaaaaggcaggatttaagagagctttcatcatcacaggg
cagacatatacacgaaaagtggatattgaagtactgtctgtgctggctagcttgggggca
tcagtgcacaagatttgcaccgacatacgcctcctggcaaacctcaaggagatggaggaa
ccctttgaaaaacagcagattggctcaagtgcgatgccatataagcggaatcccatgcgt
tcagaacgttgctgcagtcttgcccgccacctgatgacccttgtcatggacccgctacag
acagcatctgtccagtggtttgaacgcacactggatgatagtgccaaccgacggatctgt
ttggccgaggcatttcttaccgcagatactatattgaatacgctgcagaacatttctgaa
ggattggtcgtgtaccccaaagtaattgaacggcgcattcggcaagagctgcctttcatg
gccacagagaacatcatcatggccatggtcaaagctggaggtagccgccaggattgccat
gagaaaatcagagtgctttctcagcaggcagcttctgtggttaagcaggaagggggtgac
aatgacctcatagagcgtatccaggttgatgcctacttcagtcccattcactcccagttg
gatcatttactggatccttcttctttcactggtcgtgcctcccagcaggtgcagagattc
ttagaagaggaggtgtatcccctgttaaaaccatatgaaagcgtgatgaaggtgaaagca
gaattatgtctgtag

DBGET integrated database retrieval system