KEGG   Homo sapiens (human): 1581Help
Entry
1581              CDS       T01001                                 

Gene name
CYP7A1, CP7A, CYP7, CYPVII
Definition
cytochrome P450, family 7, subfamily A, polypeptide 1 (EC:1.14.13.17)
Orthology
K00489  
cholesterol 7alpha-monooxygenase [EC:1.14.13.17]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Steroid hormone biosynthesis
Metabolic pathways
PPAR signaling pathway
Bile secretion
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Class
Metabolism; Lipid metabolism; Primary bile acid biosynthesis [PATH:hsa00120]
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q11-q12
AA seq 504 aa AA seqDB search
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGN
TTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMF
EAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAE
SLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQ
MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK
TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLD
QSRAGLGILPPLNDIEFKYKFKHL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccacatctttgatttgggggattgctatagcagcatgctgttgtctatggctt
attcttggaattaggagaaggcaaacgggtgaaccacctctagagaatggattaattcca
tacctgggctgtgctctgcaatttggtgccaatcctcttgagttcctcagagcaaatcaa
aggaaacatggtcatgtttttacctgcaaactaatgggaaaatatgtccatttcatcaca
aatcccttgtcataccataaggtgttgtgccacggaaaatattttgattggaaaaaattt
cactttgctacttctgcgaaggcatttgggcacagaagcattgacccgatggatggaaat
accactgaaaacataaacgacactttcatcaaaaccctgcagggccatgccttgaattcc
ctcacggaaagcatgatggaaaacctccaacgtatcatgagacctccagtctcctctaac
tcaaagaccgctgcctgggtgacagaagggatgtattctttctgctaccgagtgatgttt
gaagctgggtatttaactatctttggcagagatcttacaaggcgggacacacagaaagca
catattctaaacaatcttgacaacttcaagcaattcgacaaagtctttccagccctggta
gcaggcctccccattcacatgttcaggactgcgcacaatgcccgggagaaactggcagag
agcttgaggcacgagaacctccaaaagagggaaagcatctcagaactgatcagcctgcgc
atgtttctcaatgacactttgtccacctttgatgatctggagaaggccaagacacacctc
gtggtcctctgggcatcgcaagcaaacaccattccagcgactttctggagtttatttcaa
atgattaggaacccagaagcaatgaaagcagctactgaagaagtgaaaagaacattagag
aatgctggtcaaaaagtcagcttggaaggcaatcctatttgtttgagtcaagcagaactg
aatgacctgccagtattagatagtataatcaaggaatcgctgaggctttccagtgcctcc
ctcaacatccggacagctaaggaggatttcactttgcaccttgaggacggttcctacaac
atccgaaaagatgacatcatagctctttacccacagttaatgcacttagatccagaaatc
tacccagaccctttgacttttaaatatgataggtatcttgatgaaaacgggaagacaaag
actaccttctattgtaatggactcaagttaaagtattactacatgccctttggatcggga
gctacaatatgtcctggaagattgttcgctatccacgaaatcaagcaatttttgattctg
atgctttcttattttgaattggagcttatagagggccaagctaaatgtccacctttggac
cagtcccgggcaggcttgggcattttgccgccattgaatgatattgaatttaaatataaa
ttcaagcatttgtga

DBGET integrated database retrieval system