KEGG   Homo sapiens (human): 158131Help
Entry
158131            CDS       T01001                                 

Gene name
OR1Q1, HSTPCR106, OR1Q2, OR1Q3, OR9-25, OR9-A, OST226, OST226OR9-A, TPCR106
Definition
olfactory receptor, family 1, subfamily Q, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.2
AA seq 314 aa AA seqDB search
MDNSNWTSVSHFVLLGISTHPEEQIPLFLVFSLMYAINISGNLAIITLILSAPRLHIPMY
IFLSNLALTDICFTSTTVPKMLQIIFSPTKVISYTGCLAQTYFFICFAVMENFILAVMAY
DRYIAICHPFHYTMILTRMLCVKMVVMCHALSHLHAMLHTFLIGQLIFCADNRIPHFFCD
LYALMKISCTSTYLNTLMIHTEGAVVISGALAFITASYACIILVVLRIPSAKGRWKTFST
CGSHLTVVAIFYGTLSWVYFRPLSSYSVTKGRIITVVYTVVTPMLNPFIYSLRNGDVKGG
FMKWMSRMQTFFFR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacaacagcaactggaccagtgtgtcccattttgttctcttgggcatttccacccac
ccagaagagcaaatcccactcttccttgttttctcactcatgtacgcaatcaatatttct
ggcaacttggccatcatcacactgattctctctgctccacgcctccacatccccatgtac
atcttcctcagtaacttggccttgacagacatctgcttcacctccaccacggtccccaag
atgctgcagattattttctcccctacaaaggtaatttcctacacaggctgtttagcccaa
acttatttcttcatttgcttcgccgtcatggaaaacttcatcctggctgtgatggcctat
gacaggtacattgccatctgccaccctttccactacactatgatcctgactagaatgctg
tgtgtgaagatggtggtcatgtgccatgctctctcccaccttcatgccatgctgcatacc
tttctcataggccaactaatcttctgtgcagataacagaatcccccacttcttctgtgac
ctctacgctctgatgaagatctcctgcaccagcacctacctcaacacccttatgattcac
acagaaggtgctgttgtaatcagtggagctctggccttcattactgcctcctatgcctgc
atcatcctggtggtcctccggatcccctcagccaagggcaggtggaaaaccttttctacc
tgcggctcccacctcactgtggtggccatattctatggcaccctcagttgggtctacttc
cggcccctttccagctattcagtgaccaagggtcgcattataacagtcgtgtacacagtg
gtgactcccatgctgaaccccttcatctacagcctgaggaatggggatgtcaagggaggc
ttcatgaaatggatgagcagaatgcagacttttttctttagataa

DBGET integrated database retrieval system