KEGG   Homo sapiens (human): 158131Help
Entry
158131            CDS       T01001                                 

Gene name
OR1Q1, HSTPCR106, OR1Q2, OR1Q3, OR9-25, OR9-A, OST226, OST226OR9-A, TPCR106
Definition
(RefSeq) olfactory receptor family 1 subfamily Q member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    158131 (OR1Q1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    158131 (OR1Q1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 158131
NCBI-ProteinID: NP_036496
HGNC: 8223
Ensembl: ENSG00000165202
Vega: OTTHUMG00000020615
Pharos: Q15612(Tdark)
UniProt: Q15612
Position
9q33.2
AA seq 314 aa AA seqDB search
MDNSNWTSVSHFVLLGISTHPEEQIPLFLVFSLMYAINISGNLAIITLILSAPRLHIPMY
IFLSNLALTDICFTSTTVPKMLQIIFSPTKVISYTGCLAQTYFFICFAVMENFILAVMAY
DRYIAICHPFHYTMILTRMLCVKMVVMCHALSHLHAMLHTFLIGQLIFCADNRIPHFFCD
LYALMKISCTSTYLNTLMIHTEGAVVISGALAFITASYACIILVVLRIPSAKGRWKTFST
CGSHLTVVAIFYGTLSWVYFRPLSSYSVTKGRIITVVYTVVTPMLNPFIYSLRNGDVKGG
FMKWMSRMQTFFFR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacaacagcaactggaccagtgtgtcccattttgttctcttgggcatttccacccac
ccagaagagcaaatcccactcttccttgttttctcactcatgtacgcaatcaatatttct
ggcaacttggccatcatcacactgattctctctgctccacgcctccacatccccatgtac
atcttcctcagtaacttggccttgacagacatctgcttcacctccaccacggtccccaag
atgctgcagattattttctcccctacaaaggtaatttcctacacaggctgtttagcccaa
acttatttcttcatttgcttcgccgtcatggaaaacttcatcctggctgtgatggcctat
gacaggtacattgccatctgccaccctttccactacactatgatcctgactagaatgctg
tgtgtgaagatggtggtcatgtgccatgctctctcccaccttcatgccatgctgcatacc
tttctcataggccaactaatcttctgtgcagataacagaatcccccacttcttctgtgac
ctctacgctctgatgaagatctcctgcaccagcacctacctcaacacccttatgattcac
acagaaggtgctgttgtaatcagtggagctctggccttcattactgcctcctatgcctgc
atcatcctggtggtcctccggatcccctcagccaagggcaggtggaaaaccttttctacc
tgcggctcccacctcactgtggtggccatattctatggcaccctcagttgggtctacttc
cggcccctttccagctattcagtgaccaagggtcgcattataacagtcgtgtacacagtg
gtgactcccatgctgaaccccttcatctacagcctgaggaatggggatgtcaagggaggc
ttcatgaaatggatgagcagaatgcagacttttttctttagataa

DBGET integrated database retrieval system