KEGG   Homo sapiens (human): 1582Help
Entry
1582              CDS       T01001                                 

Gene name
CYP8B1, CP8B, CYP12
Definition
cytochrome P450, family 8, subfamily B, polypeptide 1 (EC:1.14.13.95)
Orthology
K07431  
sterol 12-alpha-hydroxylase [EC:1.14.13.95 1.14.13.96]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
PPAR signaling pathway
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    1582 (CYP8B1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    1582 (CYP8B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.95  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     1582 (CYP8B1)
    1.14.13.96  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     1582 (CYP8B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP8 family
   1582 (CYP8B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22.1
AA seq 501 aa AA seqDB search
MVLWGPVLGALLVVIAGYLCLPGMLRQRRPWEPPLDKGTVPWLGHAMAFRKNMFEFLKRM
RTKHGDVFTVQLGGQYFTFVMDPLSFGSILKDTQRKLDFGQYAKKLVLKVFGYRSVQGDH
EMIHSASTKHLRGDGLKDLNETMLDSLSFVMLTSKGWSLDASCWHEDSLFRFCYYILFTA
GYLSLFGYTKDKEQDLLQAGELFMEFRKFDLLFPRFVYSLLWPREWLEVGRLQRLFHKML
SVSHSQEKEGISNWLGNMLQFLREQGVPSAMQDKFNFMMLWASQGNTGPTSFWALLYLLK
HPEAIRAVREEATQVLGEARLETKQSFAFKLGALQHTPVLDSVVEETLRLRAAPTLLRLV
HEDYTLKMSSGQEYLFRHGDILALFPYLSVHMDPDIHPEPTVFKYDRFLNPNGSRKVDFF
KTGKKIHHYTMPWGSGVSICPGRFFALSEVKLFILLMVTHFDLELVDPDTPLPHVDPQRW
GFGTMQPSHDVRFRYRLHPTE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttctctggggtccagtgctgggagctctgctggtggtcattgctggatacctgtgc
ctgccagggatgctccgacaacgcaggccatgggagccccctctggacaagggtaccgtg
ccctggcttggccatgccatggctttccggaagaatatgtttgaatttctgaagcgcatg
aggaccaagcatggggatgtgttcacagtgcagctagggggccagtacttcaccttcgtc
atggaccccctctcctttggctccatcctcaaggacacacagagaaaactagactttggg
caatatgcaaaaaaactggtgctgaaggtatttggataccgttcagtgcaaggggaccat
gagatgatacactcagccagcaccaagcatctgaggggggatggcttgaaggatcttaat
gagaccatgctggacagcctgtcctttgtaatgctgacgtccaaaggctggagtctggat
gccagttgctggcatgaggacagcctctttcgcttctgctattacatcttgttcacagct
ggctacctgagcttgttcggctacacgaaggacaaggagcaggacctgctacaggcagga
gagttattcatggagttccgcaagtttgaccttcttttcccaaggtttgtctactccctg
ctgtggccccgggagtggctagaagtgggccgactccagcgtctctttcacaagatgctc
tccgtgagccacagccaggagaaggagggcatcagcaactggctgggcaacatgcttcag
tttctgagggagcagggggtaccctcagctatgcaggacaagttcaacttcatgatgctc
tgggcctcccaggggaacacggggcctacctctttctgggccctcttgtacctcctgaag
cacccagaagctattcgggctgtgagggaggaagctacccaggtcctgggtgaggccagg
ctggagaccaagcagtcctttgccttcaaactcggtgccctgcaacacaccccagttcta
gacagcgtggtggaggagacgctgcggctgagggctgcacccaccctcctcaggttggtt
catgaagactataccctgaagatgtccagtgggcaggagtatctgttccgccatggagac
atcctggccctctttccctacctctcagtgcacatggaccctgacatccaccctgagccc
accgtcttcaagtacgatcgcttcctcaaccctaatggcagccggaaagtggacttcttc
aagacaggcaagaagatccaccactacaccatgccctggggttcgggcgtttccatctgc
cctgggaggttctttgcactcagtgaggtgaagctctttatcctgcttatggtcacacac
tttgacttagagttggtggaccctgacacaccactaccccatgttgacccgcagcgctgg
ggttttggcaccatgcagcccagccacgatgtgcgcttccgctaccgcctgcatcctaca
gagtga

DBGET integrated database retrieval system