KEGG   Homo sapiens (human): 158219Help
Entry
158219            CDS       T01001                                 

Gene name
TTC39B, C9orf52
Definition
(RefSeq) tetratricopeptide repeat domain 39B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q5VTQ0(Tbio)
UniProt: 
Position
9p22.3
AA seq 682 aa AA seqDB search
MDAVLACRLRGRGNRVAALRPRPRPGGSAGPSPFALLCAGLSPEPRAGVGSEFPAWFLGG
SSQRRNMALLGSRAELEADEDVFEDALETISISSHSDMATSSLHFASCDTQQAPRQRGAS
TVSSSSSTKVDLKSGLEECAVALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQA
VLTFEQQDIQNGISAMKDALQTCQKYRKKYTVVESFSSLLSRGSLEQLSEEEMHAEICYA
ECLLQKAALTFVQDENMINFIKGGLKIRTSYQIYKECLSILHEIQKNKLQQEFFYEFEGG
VKLGSGAFNLMLSLLPARIIRLLEFIGFSGNRELGLLQLREGASGRSMRSALCCLTILAF
HTYISLILGTGEVNVAEAERLLAPFLQQFPNGSLVLFYHARIELLKGNLEEAQEVFQKCI
SVQEEWKQFHHLCYWELMWINVFQQNWMQAYYYSDLLCKESKWSKATYVFLKAAILSMLP
EEDVVATNENVVTLFRQVDSLKQRIAGKSIPTEKFAVRKARRYSASLPAPVKLILPALEM
MYVWNGFSIVSKRKDLSENLLVTVEKAEAALQSQNFNSFSVDDECLVKLLKGCCLKNLQR
PLQAELCYNHVVESEKLLKYDHYLVPFTLFELASLYKSQGEIDKAIKFLETARNNYKDYS
LESRLHFRIQAALHLWRKPSSD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgtgctggcctgccggctccgggggcggggaaatcgagtagctgcactcagg
ccccgcccgagacccggagggagcgccgggccgtccccttttgccctcctttgcgctggg
ctgagcccagagccgagagcaggagtcggctctgagttccctgcttggtttttgggtggc
agcagccagaggaggaatatggcgctcttaggcagccgagcggagctggaagcggacgag
gacgttttcgaagatgccttggaaaccatctcaatatcttctcactcagatatggcaaca
agcagccttcactttgcatcatgtgatacacaacaggcgcccagacagcgcggagcgtct
actgtcagcagttcatcatcaaccaaggtggatctcaagagtggcctcgaagaatgtgct
gtggcattgaacttatttctaagcaacaaatttacagacgccttagaattgcttcgcccc
tgggctaaggagagtatgtaccatgccttgggctacagtaccattgtggtgttgcaggct
gtcctgaccttcgagcaacaggacatccagaacggcatttctgccatgaaggacgcttta
caaacctgccaaaaatacaggaaaaaatacacagttgtagaatctttctcaagtcttctt
tctagaggatccctggagcaactgagtgaagaggaaatgcatgctgaaatctgttatgcc
gagtgtctcctacagaaagctgcactcacgtttgtgcaggatgaaaatatgatcaacttc
atcaaaggtggactcaaaattagaacaagttaccaaatatataaagaatgtctttctatc
ctgcatgaaattcagaagaacaaacttcagcaggaattcttctatgagtttgaagggggt
gtcaagcttggcagtggggcctttaatttgatgctgtcccttttaccagcaaggattatc
agactactagaatttattggattttctgggaatagggagttgggcctcctgcagttacgt
gaaggtgcttcaggaaggagcatgaggtctgcactgtgctgcttaaccatcttagctttt
catacttacatctccctaatacttggtacaggagaagtgaatgttgcggaagcagagcgt
ctcctggcacccttcctccagcagtttccaaatggctcactcgtgttgttttatcatgcc
cgaatagagttgctgaaagggaatcttgaagaggcacaagaagtatttcaaaaatgcatt
tcagttcaagaagaatggaaacagtttcaccatctctgctactgggagctaatgtggatt
aatgttttccaacaaaactggatgcaggcatattactattcagatctgctttgcaaagag
agtaaatggtccaaggcaacttatgtgttcttgaaagcagcaattttgagtatgcttcca
gaggaggatgtagtagcaacgaatgagaatgtggtaactttattcagacaggtggacagc
ttgaagcagagaattgccgggaaatctatccctactgagaagtttgctgtgaggaaggct
cggcgttactccgcctccttacctgcacctgtgaagctcatcttacctgccctggaaatg
atgtatgtctggaatggtttttcaatagtgagcaaaagaaaagacctttctgaaaatctg
ttagtaactgttgaaaaagctgaggcagctttacaaagtcaaaattttaacagcttctct
gtggatgatgagtgcttagtgaagttacttaaaggatgttgcctcaagaacttacagcgg
cccttgcaagctgaactatgttacaatcatgttgtggaaagtgaaaagctactgaagtat
gaccactacctagtgccgttcactctatttgaattggcatctttgtataaaagccagggg
gaaattgacaaggccataaagttcctagaaactgcaaggaacaactacaaagattactcc
ctggagtccagactacacttcagaattcaggcagctcttcacctctggagaaaaccttcc
tcagattga

DBGET integrated database retrieval system