KEGG   Homo sapiens (human): 1583Help
Entry
1583              CDS       T01001                                 

Gene name
CYP11A1, CYP11A, CYPXIA1, P450SCC
Definition
(RefSeq) cytochrome P450 family 11 subfamily A member 1 (EC:1.14.15.6)
  KO
K00498  
cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Aldosterone synthesis and secretion
Module
Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Disease
H00216  
Congenital adrenal hyperplasia (CAH)
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1583 (CYP11A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    1583 (CYP11A1)
   04925 Aldosterone synthesis and secretion
    1583 (CYP11A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     1583 (CYP11A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP11 family
   1583 (CYP11A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q23-q24
AA seq 521 aa AA seqDB search
MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWL
NLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVS
VLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQM
FHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG
ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIY
ALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINML
ENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctggccaagggtcttcccccacgctcagtcctggtcaaaggctgccagacctttctg
agtgcccccagggaggggctggggcgtctcagggtgcccactggcgagggagctggcatc
tccacccgcagtcctcgccccttcaatgagatcccctctcctggtgacaatggctggcta
aacctgtaccatttctggagggagacgggcacacacaaagtccaccttcaccatgtccag
aatttccagaagtatggcccgatttacagggagaagctcggcaacgtggagtcggtttat
gtcatcgaccctgaagatgtggcccttctctttaagtccgagggccccaacccagaacga
ttcctcatcccgccctgggtcgcctatcaccagtattaccagagacccataggagtcctg
ttgaagaagtcggcagcctggaagaaagaccgggtggccctgaaccaggaggtgatggct
ccagaggccaccaagaactttttgcccctgttggatgcagtgtctcgggacttcgtcagt
gtcctgcacaggcgcatcaagaaggcgggctccggaaattactcgggggacatcagtgat
gacctgttccgctttgcctttgagtccatcactaacgtcatttttggggagcgccagggg
atgctggaggaagtagtgaaccccgaggcccagcgattcattgatgccatctaccagatg
ttccacaccagcgtccccatgctcaaccttcccccagacctgttccgtctgttcaggacc
aagacctggaaggaccatgtggctgcatgggacgtgattttcagtaaagctgacatatac
acccagaacttctactgggaattgagacagaaaggaagtgttcaccacgattaccgtggc
atcctctacagactcctgggagacagcaagatgtccttcgaggacatcaaggccaacgtc
acagagatgctggcaggaggggtggacacgacgtccatgaccctgcagtggcacttgtat
gagatggcacgcaacctgaaggtgcaggatatgctgcgggcagaggtcttggctgcgcgg
caccaggcccagggagacatggccacgatgctacagctggtccccctcctcaaagccagc
atcaaggagacactaagacttcaccccatctccgtgaccctgcagagatatcttgtaaat
gacttggttcttcgagattacatgattcctgccaagacactggtgcaagtggccatctat
gctctgggccgagagcccaccttcttcttcgacccggaaaattttgacccaacccgatgg
ctgagcaaagacaagaacatcacctacttccggaacttgggctttggctggggtgtgcgg
cagtgtctgggacggcggatcgctgagctagagatgaccatcttcctcatcaatatgctg
gagaacttcagagttgaaatccaacacctcagcgatgtgggcaccacattcaacctcatt
ctgatgcctgaaaagcccatctccttcaccttctggccctttaaccaggaagcaacccag
cagtga

DBGET integrated database retrieval system