KEGG   Homo sapiens (human): 1583Help
Entry
1583              CDS       T01001                                 

Gene name
CYP11A1, CYP11A, CYPXIA1, P450SCC
Definition
(RefSeq) cytochrome P450 family 11 subfamily A member 1
  KO
K00498  
cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Aldosterone synthesis and secretion
Cortisol synthesis and secretion
Module
Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Disease
H00216  
Congenital adrenal hyperplasia (CAH)
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1583 (CYP11A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    1583 (CYP11A1)
   04925 Aldosterone synthesis and secretion
    1583 (CYP11A1)
   04927 Cortisol synthesis and secretion
    1583 (CYP11A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     1583 (CYP11A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP11 family
   1583 (CYP11A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P05108(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
15q24.1
AA seq 521 aa AA seqDB search
MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWL
NLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVS
VLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQM
FHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG
ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIY
ALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINML
ENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctggccaagggtcttcccccacgctcagtcctggtcaaaggctgccagacctttctg
agtgcccccagggaggggctggggcgtctcagggtgcccactggcgagggagctggcatc
tccacccgcagtcctcgccccttcaatgagatcccctctcctggtgacaatggctggcta
aacctgtaccatttctggagggagacgggcacacacaaagtccaccttcaccatgtccag
aatttccagaagtatggcccgatttacagggagaagctcggcaacgtggagtcggtttat
gtcatcgaccctgaagatgtggcccttctctttaagtccgagggccccaacccagaacga
ttcctcatcccgccctgggtcgcctatcaccagtattaccagagacccataggagtcctg
ttgaagaagtcggcagcctggaagaaagaccgggtggccctgaaccaggaggtgatggct
ccagaggccaccaagaactttttgcccctgttggatgcagtgtctcgggacttcgtcagt
gtcctgcacaggcgcatcaagaaggcgggctccggaaattactcgggggacatcagtgat
gacctgttccgctttgcctttgagtccatcactaacgtcatttttggggagcgccagggg
atgctggaggaagtagtgaaccccgaggcccagcgattcattgatgccatctaccagatg
ttccacaccagcgtccccatgctcaaccttcccccagacctgttccgtctgttcaggacc
aagacctggaaggaccatgtggctgcatgggacgtgattttcagtaaagctgacatatac
acccagaacttctactgggaattgagacagaaaggaagtgttcaccacgattaccgtggc
atcctctacagactcctgggagacagcaagatgtccttcgaggacatcaaggccaacgtc
acagagatgctggcaggaggggtggacacgacgtccatgaccctgcagtggcacttgtat
gagatggcacgcaacctgaaggtgcaggatatgctgcgggcagaggtcttggctgcgcgg
caccaggcccagggagacatggccacgatgctacagctggtccccctcctcaaagccagc
atcaaggagacactaagacttcaccccatctccgtgaccctgcagagatatcttgtaaat
gacttggttcttcgagattacatgattcctgccaagacactggtgcaagtggccatctat
gctctgggccgagagcccaccttcttcttcgacccggaaaattttgacccaacccgatgg
ctgagcaaagacaagaacatcacctacttccggaacttgggctttggctggggtgtgcgg
cagtgtctgggacggcggatcgctgagctagagatgaccatcttcctcatcaatatgctg
gagaacttcagagttgaaatccaacacctcagcgatgtgggcaccacattcaacctcatt
ctgatgcctgaaaagcccatctccttcaccttctggccctttaaccaggaagcaacccag
cagtga

DBGET integrated database retrieval system