KEGG   Homo sapiens (human): 158326Help
Entry
158326            CDS       T01001                                 

Gene name
FREM1, BNAR, C9orf143, C9orf145, C9orf154, MOTA, TILRR, TRIGNO2
Definition
FRAS1 related extracellular matrix 1
Organism
hsa  Homo sapiens (human)
Disease
H00685  
Bifid nose with or without anorectal and renal anomalies
H00686  
Manitoba oculotrichoanal syndrome
H01207  
Trigonocephaly
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p22.3
AA seq 715 aa AA seqDB search
MVTQESMLKAALPLFTRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGL
LSPDLLQLTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVAYRHSGG
DSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQVDQLDKTAPRITLLHSPSQVGLLKN
GCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTI
LYIINPSLEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTEYEVCENVGLLPLEII
RRGYSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQFDPGMSTKMWNIAITYDGLEEDDEV
FEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSYSSNQSKHSTWEKGIWHLLPPGSSSS
TTSGSFHLERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVYRNGTD
IIYNYHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTIKVAELPQADKVESTTDSHFPRQD
QLPSFPKNCTLELKGLFHFEEGIQKLYQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYC
HILITEQKGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHW
EWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKWQTKDCRRAKPHNYVCSRKL
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggtgacacaagaatccatgctgaaggctgccttgcctctctttaccagattcatcatc
agcaatggactgcggaccgagcacggggtgtttgagatcacactggagactgtggacaga
gccctgcctgtggtaaccaggaacaaggggttgagactggcccaaggggccgtgggcctg
ctttcccctgacctccttcagctgaccgaccctgatacacctgcggagaacctcaccttc
ctcttggttcagctcccccagcatggccagctctacctgtgggggacagggctacttcaa
cacaatttcacccagcaggatgtggacagcaagaatgtggcctatcggcactcaggaggg
gactcccagactgactgctttactttcatggccacagatgggacaaaccaaggctttatt
gtgaatgggagagtgtgggaagaacctgttttattcaccattcaggtagaccaattggac
aaaacagctcctcgtatcacactcttgcattccccttctcaagtggggctcctgaaaaat
ggctgctacgggatttacatcacttcccgcgtgttgaaggcatcagaccctgacactgag
gacgatcagatcatctttaaaattctacaaggcccaaaacatggacatctggagaacaca
acaacaggtgaatttatccatgagaaatttagccaaaaggacttaaacagtaagactatt
ctttacatcataaacccatctttggaagtaaattcagataccgtggaatttcaaatcatg
gaccccacagggaactcggccactcctcaaattttggaactgaagtggtctcatattgaa
tggtcacagaccgaatatgaagtctgtgagaatgtgggtttgttgcccttggaaattatc
agaaggggatattccatggactcggcctttgtgggtataaaggtcaaccaagtgtcagct
gcagttggaaaagatttcaccgtgattccatctaaactgattcagtttgacccaggaatg
tcaactaagatgtggaatatagcaattacctatgacggattagaggaagatgatgaggtc
tttgaagtaattctgaactcccctgtgaatgcagttcttggcacaaagacaaaagctgca
gtgaaaattttggactcaaaaggaggacaatgccatccttcatattcctccaaccaaagc
aagcacagcacatgggagaagggcatttggcatctgctgcccccagggtcttcctcatcc
accacttctggttcctttcatctggaaagaagacctcttccatcttccatgcagctagca
gtcatcaggggagacaccctgcggggctttgattctacagatctttctcaaaggaagctt
aggacccgtgggaatggcaaaacagttcgtccatcctctgtttatagaaatggaacagac
atcatctataattatcatgggatagtttccttgaaactggaggatgacagtttcccaact
cacaaaaggaaggccaaagtatccatcattagtcagccacaaaagacaatcaaagtggca
gaactgcctcaagcagataaggtggaatccacaactgactcacacttccccagacaggac
cagttgccctcatttccaaagaactgcactctggaattaaagggactcttccattttgaa
gaaggcatccagaagctgtatcagtgcaatgggatcgcctggaaagcctggagtccccaa
accaaggatgtggaagacaaatcctgtccagccgggtggcaccagcactcaggctactgt
cacatcttgatcacagagcagaaaggcacctggaatgcggctgcccaagcttgcagggaa
caatacctgggcaaccttgtaactgtattctccaggcagcacatgcggtggctctgggac
attggtgggagaaagtccttttggataggtttgaacgaccaagtgcatgctggccactgg
gagtggatcggtggtgaacctgttgccttcaccaatgggagaagagggccctctcaacgc
tccaagcttggaaagagctgtgttttggttcaaagacaagggaaatggcaaacaaaagac
tgtaggagagccaaacctcataattatgtgtgttccagaaaactctaa

DBGET integrated database retrieval system