KEGG   Homo sapiens (human): 158326Help
Entry
158326            CDS       T01001                                 

Gene name
FREM1, BNAR, C9orf143, C9orf145, C9orf154, MOTA, TILRR, TRIGNO2
Definition
(RefSeq) FRAS1 related extracellular matrix 1
Organism
hsa  Homo sapiens (human)
Disease
H00685  
Bifid nose with or without anorectal and renal anomalies
H00686  
Manitoba oculotrichoanal syndrome
H01207  
Trigonocephaly
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p22.3
AA seq 2179 aa AA seqDB search
MNSLSWGAANAVLLLLLLAWASPTFISINRGVRVMKGHSAFLSGDDLKFAIPKEKDACKV
EVVMNEPITQRVGKLTPQVFDCHFLPNEVKYVHNGCPILDEDTVKLRLYRFTERDTFIET
FILWVYLLEPDCNIIHMSNNVLEVPEFNGLSQAIDKNLLRFDYDRMASLECTVSLDTART
RLPAHGQMVLGEPRPEEPRGDQPHSFFPESQLRAKLKCPGGSCTPGLKKIGSLKVSCEEF
LLMGLRYQHLDPPSPNIDYISIQLDLTDTRSKIVYKSESAWLPVYIRAGIPNQIPKAAFM
AVFILEVDQFILTSLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRPISSFTW
KDLSDMQIAYQPPNSSHSERRHDEVELEVYDFFFERSAPMTVHISIRTADTNAPRVSWNT
GLSLLEGQSRAITWEQFQVVDNDDIGAVRLVTVGGLQHGWLTLRGGKGFLFTVADLQAGV
VRYHHDDSDSTKDFVVFRIFDGHHSIRHKFPINVLPKDDSPPFLITNVVIELEEGQTILI
QGSMLRASDVDASDDYIFFNITKPPQAGEIMKKPGPGLIGYPVHGFLQRDLFNGIIYYRH
FGGEIFEDSFQFVLWDSHEPPNLSVPQVATIHITPVDDQLPKEAPGVSRHLVVKETEVAY
ITKKQLHFIDSESYDRELVYTITTPPFFSFSHRHLDAGKLFMVDSIPKVVKNPTALELRS
FTQHAVNYMKVAYMPPMQDIGPHCRDVQFTFSVSNQHGGTLHGICFNITILPVDNQVPEA
FTNPLKVTEGGQSIISTEHILISDADTKLDNIDLSLRELPLHGRVELNGFPLNSGGTFSW
GDLHTLKVRYQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMN
CSEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVT
YKHTGGEIGLMPCFDTITLVVSDGEAGPFVNGCCYNGPNPSVPLHASFPVYDLNITVYPV
DNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSV
GFEKSNIGISIDSFQWKDMNAFHINYVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSII
INPTNDEAPDFVVQNITVCEGQMKELDSSIISAVDLDIPQDALLFSITQKPRHGLLIDRG
FSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKI
LKTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYYVFERLPQ
NGQLQLKIGRDWVPLSPGMKCTQEEVDLNLLRYTHTGAMDSQNQDSFTFYLWDGNNRSPA
LDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLYVITSPPRYG
QIEYVHYPGVPITNFSQMDVVGQTVCYVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLE
TVDRALPVVTRNKGLRLAQGAVGLLSPDLLQLTDPDTPAENLTFLLVQLPQHGQLYLWGT
GLLQHNFTQQDVDSKNVAYRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQV
DQLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGH
LENTTTGEFIHEKFSQKDLNSKTILYIINPSLEVNSDTVEFQIMDPTGNSATPQILELKW
SHIEWSQTEYEVCENVGLLPLEIIRRGYSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQF
DPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSYS
SNQSKHSTWEKGIWHLLPPGSSSSTTSGSFHLERRPLPSSMQLAVIRGDTLRGFDSTDLS
QRKLRTRGNGKTVRPSSVYRNGTDIIYNYHGIVSLKLEDDSFPTHKRKAKVSIISQPQKT
IKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLYQCNGIAWKA
WSPQTKDVEDKSCPAGWHQHSGYCHILITEQKGTWNAAAQACREQYLGNLVTVFSRQHMR
WLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKW
QTKDCRRAKPHNYVCSRKL
NT seq 6540 nt NT seq  +upstreamnt  +downstreamnt
atgaactctctgagttggggggctgcgaatgccgtgctgctgctgctcctcctggcctgg
gccagccccaccttcatcagcatcaaccgcggggtgagggtgatgaagggccactctgcc
ttcctgtcaggagatgacctgaagtttgccatccctaaagagaaagatgcctgcaaagtg
gaagttgtgatgaatgagccaataacccagagggttgggaaactcactccacaggtcttt
gactgccatttccttcccaacgaagtcaagtatgttcacaatggttgtccaattcttgat
gaagacacagtgaagctcagactttacagatttactgaaagagataccttcatagaaact
tttatcctgtgggtctatctcctggaaccagactgtaacatcatccatatgagtaacaat
gtgctggaggtgcctgaattcaatggcttgtcccaagcgattgataaaaatctgctcaga
ttcgattatgataggatggctagcctggaatgtaccgtcagcctggacactgcgagaact
cggctgccagcccatggccagatggttctcggggagcctcgaccagaagaacctcgtgga
gatcagccacacagttttttcccagagtcccaactgagagcaaaactgaagtgtccaggt
gggagctgtaccccaggattaaagaaaataggaagcctcaaagtgagctgtgaggagttc
ctgctgatgggccttcgttatcagcatctggatcccccttcacccaacattgattatatc
tccatccaactggacctcacagataccaggagcaaaattgtgtacaagtcagagagtgcg
tggctgcctgtctatatcagagctggaattccgaatcagattccaaaggctgcattcatg
gccgtgtttattctggaagtggatcagttcatcctgacctccttgactacatcagttctg
gactgtgaagaagatgagacccctaaacccttgctggtgttcaacattactaaagccccg
ctccagggctatgtgactcacctgttggatcacaccagaccaatctcctcattcacctgg
aaagatctcagtgacatgcagatcgcctatcagccaccaaacagcagccattctgagagg
agacatgatgaggtagaattggaggtatacgacttcttctttgaaaggagtgcacctatg
acagtccacatctccatcagaacagcagatacaaatgccccccgtgtatcctggaataca
ggtctgagtctccttgaggggcagtctcgagccatcacttgggaacagtttcaggttgtc
gacaatgacgacattggtgctgtccggctagtcaccgttggtggcctgcagcatggatgg
ctgactttaagaggggggaaagggtttctcttcaccgtggctgacctccaggctggagtt
gttcgctatcatcatgatgacagcgactccaccaaagacttcgtggtcttccggatattt
gatggccatcacagcatccgtcacaaattccccatcaacgtcttgcccaaagatgatagt
cccccgttcctcataaccaatgttgtgattgaactggaggaggggcagaccatcctgatc
cagggatccatgctgcgagcttcagatgtggacgccagtgatgactacatcttcttcaat
atcacaaagcctccacaggctggggagatcatgaagaagccagggccaggactgataggc
tatcctgtccatggcttccttcagagggatttgtttaatggaatcatttattatcgtcat
tttggtggagaaatctttgaagattcttttcaatttgtcctgtgggacagccatgaacct
ccaaatctttcagtgccacaggtggcaacaatccatataactccagtggatgaccagctt
ccaaaagaggctcctggagtttctcggcatttggttgtcaaggaaactgaggtggcctat
ataactaagaaacagctacattttatagattcagaatcatatgacagggagctggtctac
acaataactactcctccatttttctccttcagccacagacacttggatgctgggaaatta
tttatggtggacagcataccaaaagtagttaagaatcctacggccctggagctgaggtca
ttcactcagcatgctgtgaactatatgaaagtggcctacatgccccccatgcaagacatt
ggtccccattgcagagatgtccagttcacattttctgtcagtaaccaacatggcggtact
ttgcatgggatctgctttaacattacaatcctcccagtggacaatcaagttcctgaggcg
ttcaccaaccctctgaaagtgactgagggaggtcaaagcatcatcagcacagagcacatt
ctaatttctgatgcagataccaagctggacaatattgacctctccctgcgggaattgcct
ctgcacggaagggtggagctgaatggatttcctctaaattcagggggcacattttcttgg
ggcgatctccataccttaaaagttaggtatcaacatgatggaactgaagttcttcaggat
gacctactcttggaggtcaccgatggcacaaattcagcagaatttgtactacatgttgag
gtattccctgtcaacgatgagccaccagtcttaaaggctgacctcatgcctgtcatgaat
tgctcagagggaggagaggtggtcatcacctctgaatacatttttgctactgatgtggac
agcgataacttgaagttgatgtttgtgattgctcgcgaacctcagcatggggtggtgagg
agagctggagtcacagtggatcagttctctcagagagatgttatctcagaggccgtgaca
tacaaacacacaggtggcgagattggcctgatgccttgttttgacaccattacattggtg
gtttcggatggagaggctggcccttttgtgaatggctgttgctacaatggacccaatcca
tctgttccacttcatgcgtcctttccagtgtatgatctcaacatcacggtatacccagta
gacaaccagccaccttccattgcaataggtcccgtgtttgttgtagatgagggctgctca
acagcccttactgttaaccatttgtccgccactgaccctgacactgcagcagatgacttg
gaatttgttttggtttctcctcctcagtttggctacctcgaaaatatactcccttctgtg
ggttttgaaaaaagcaatattggcataagtatagattcatttcagtggaaagacatgaac
gcttttcacattaactatgtgcagtccaggcatctgaggatagaaccaactgccgaccag
ttcacggtgtacgtcacagatgggaagcatcactccttggagataccattttctattata
atcaaccccacaaatgatgaagctcctgactttgtagtgcagaatattactgtgtgtgag
ggtcagatgaaagagctggactcttccatcatcagcgctgtggacctggacattccccag
gatgccctgctgttcagcatcactcaaaagccacgccatggcctcctcatcgataggggg
tttagcaaagacttctctgagaataagcagccagccaaccctcaccagaaacatgcacct
gttcacagcttttccatggaactcctcaagactggaatgaggttgacgtacatgcatgat
gactcagagagccttgctgatgattttacaatccaattgtcagatgggaaacataagata
cttaaaaccatttcagtagaggtcatcccagttaatgatgaaaaaccaatgctgagcaag
aaggctgaaattgcaatgaatatgggtgaaactcgtattatttccagtgctattctttca
gccatagatgaagactcacccagggagaagatttactatgtatttgaaaggcttccccaa
aatgggcaacttcagcttaagatagggagggactgggttcctctctcccctggcatgaaa
tgcactcaggaggaagtggatctgaacttgctgagatacacacacaccggggcaatggat
tcccagaatcaagatagcttcaccttctacctttgggatggcaacaacaggtcccctgct
cttgactgtcaaatcaccatcaaggacatggaaaaaggtgatattgtcatccttacaaaa
ccactcgtggtgtctaaaggtgatagaggtttcttaacaaccaccacgctcctggctgtg
gacggaacagacaagcctgaggaactgctctatgtcatcacctcccctccgcgatatggc
cagatcgaatatgttcactatcctggagttcccattacaaacttcagccaaatggatgta
gtggggcagacagtttgctatgtacacaagagcaaggtgactgtctccagtgacagattc
agattcatcatcagcaatggactgcggaccgagcacggggtgtttgagatcacactggag
actgtggacagagccctgcctgtggtaaccaggaacaaggggttgagactggcccaaggg
gccgtgggcctgctttcccctgacctccttcagctgaccgaccctgatacacctgcggag
aacctcaccttcctcttggttcagctcccccagcatggccagctctacctgtgggggaca
gggctacttcaacacaatttcacccagcaggatgtggacagcaagaatgtggcctatcgg
cactcaggaggggactcccagactgactgctttactttcatggccacagatgggacaaac
caaggctttattgtgaatgggagagtgtgggaagaacctgttttattcaccattcaggta
gaccaattggacaaaacagctcctcgtatcacactcttgcattccccttctcaagtgggg
ctcctgaaaaatggctgctacgggatttacatcacttcccgcgtgttgaaggcatcagac
cctgacactgaggacgatcagatcatctttaaaattctacaaggcccaaaacatggacat
ctggagaacacaacaacaggtgaatttatccatgagaaatttagccaaaaggacttaaac
agtaagactattctttacatcataaacccatctttggaagtaaattcagataccgtggaa
tttcaaatcatggaccccacagggaactcggccactcctcaaattttggaactgaagtgg
tctcatattgaatggtcacagaccgaatatgaagtctgtgagaatgtgggtttgttgccc
ttggaaattatcagaaggggatattccatggactcggcctttgtgggtataaaggtcaac
caagtgtcagctgcagttggaaaagatttcaccgtgattccatctaaactgattcagttt
gacccaggaatgtcaactaagatgtggaatatagcaattacctatgacggattagaggaa
gatgatgaggtctttgaagtaattctgaactcccctgtgaatgcagttcttggcacaaag
acaaaagctgcagtgaaaattttggactcaaaaggaggacaatgccatccttcatattcc
tccaaccaaagcaagcacagcacatgggagaagggcatttggcatctgctgcccccaggg
tcttcctcatccaccacttctggttcctttcatctggaaagaagacctcttccatcttcc
atgcagctagcagtcatcaggggagacaccctgcggggctttgattctacagatctttct
caaaggaagcttaggacccgtgggaatggcaaaacagttcgtccatcctctgtttataga
aatggaacagacatcatctataattatcatgggatagtttccttgaaactggaggatgac
agtttcccaactcacaaaaggaaggccaaagtatccatcattagtcagccacaaaagaca
atcaaagtggcagaactgcctcaagcagataaggtggaatccacaactgactcacacttc
cccagacaggaccagttgccctcatttccaaagaactgcactctggaattaaagggactc
ttccattttgaagaaggcatccagaagctgtatcagtgcaatgggatcgcctggaaagcc
tggagtccccaaaccaaggatgtggaagacaaatcctgtccagccgggtggcaccagcac
tcaggctactgtcacatcttgatcacagagcagaaaggcacctggaatgcggctgcccaa
gcttgcagggaacaatacctgggcaaccttgtaactgtattctccaggcagcacatgcgg
tggctctgggacattggtgggagaaagtccttttggataggtttgaacgaccaagtgcat
gctggccactgggagtggatcggtggtgaacctgttgccttcaccaatgggagaagaggg
ccctctcaacgctccaagcttggaaagagctgtgttttggttcaaagacaagggaaatgg
caaacaaaagactgtaggagagccaaacctcataattatgtgtgttccagaaaactctaa

DBGET integrated database retrieval system