KEGG   Homo sapiens (human): 158358Help
Entry
158358            CDS       T01001                                 

Definition
KIAA2026
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p24.1
AA seq 2103 aa AA seqDB search
MSVPGTPGAMEPAGEEERPPPAAEGEDDEEEVAAAAQTSGPAHGRSASSLEDADDQEEEM
EAMVIGGGCCKEQELTYELQQGYRILGEFLQEKHRGLTAPFLQPLGGVATAEEEVAEGPR
SGGRGGRAFPQQPGQGMCLLQMEEKFASGQYGGITEFVADFRLMLETCYRLHGVDHWISK
QGQKLEMMLEQKLALLSRHLREKTTIAVTSRGYYGLEDEKGTACTSTRRRSTPRSLAGLT
SGVFESIMVQVLRQEEQLRAKEEKRLREQERKEAEEASQKEIEEWERKLLAQAAPTCMET
MWEIPAIGHFLCLAQQILNLPEIVFYELERCLLMPQCNAFLSKIMTSLLSPPHRRPTLHR
RPTLPYRTWEAALRQKVQQWYTAVGQTENPDNCAEKLGLCPQFFKVLGEVNPLEEKPFHE
LPFYQKVWLLKGLCDFVYETQKEVQDAVLGQPIHECREVILGYDYLENAYVHFPQFCGAD
VRIYKQRPFQAPEFPIPPIKIQRVPRIKLEKLKCDYVSTSNGEHRCSRDSLPSSFKKEQE
NNFDPACCPAKMILDNHDISVEMGVKSNYEIRIRRPCEIKKTDCCKENLEKPRSPGEVTG
FGEPLSPGEIRFIENQEKYGEASRIKIEPSPLKENTLKSCQIHVNGSHSDHPEINCHKVV
RDILLEQSLQSHKKLKLTKMRAKKKKKKKKKLKDVLNENLQRKREGLHSLAFKSYKPEIQ
NKLLIIKKKAKHKKHKSGKKSVSKKAITKKRKTVIKSPTVPEFQLICTNLDELRELITKI
ENELKDLENSRKKSGKWYHRRQAVKELHSTLIRLLNELLPWEPKLMKAFQRNRSRLKKDY
DDFRRQPDHDTFNRELWTTDEGEGDLGKDSPKGEISKSIDSTEPLDILEKDHFDSDDMKL
SEIDFPMARSKLLKKELPSKDLPKTLLKTLKRQSKQTDYVDDSTKELSPRKKAKLSTNET
TVENLESDVQIDCFSESKHTEPSFPESFASLDSVPVSTLQKGTKPIQALLAKNIGNKVTL
TNQLPPSTGRNALAVEKPVLSPPEASPIKPALTCHTNTKGPLQMVYKMPCGQWLPIDLQN
SSVKIQVQPMVDPKTGEKIMQQVLILPKNFVIQHKEGKAVAKEVPPLQQKGTEQHCSSFP
QTTNINSSLASVFVNSPGTVSTQLPNTAFNKTITPLSNISSARPQPLSPVTSVSNLLTPS
VKTSQSEAGKAKNAVSAATFSLPSASPTISSTGQPLSSTTTLNGSTNPGSSFNCFAQQTA
DSSEAKQELKTVCIRDSQSILVRTRGGNTGVVKVQTNPDQNSPNTVSSSSVFTFAPQLQA
FLVPKSTTSSSAFSPVAGTTTTSSLSPFSQTPTSVSIPASFAPSMGKNLKLTLGHTTGSG
DLGHVIDKTSHMPSSPLKSSICSSTLLPSTTSSSVSVISISAANFGQNNANIIHTPTKQQ
QVDYITKSYPVTRSEATAATNGDVISGTPVQKLMLVSAPSILSSGNGTAINMTPALTSTG
VSAQKLVFINAPVPSGTSTPTLVAESLKQTLPPPLHKAYVKTPEQPQIVLIPSTVGTPIK
INSSPAVSQIKDVKIGLNIGQAIVNTSGTVPAIPSINILQNVTPKGEDKSSKGYILPLST
SGNSVPVSSNFVSQNITPVNESVVSSARAVNVLSVTGANLSLGSFPVTSASASAGAQPPV
LVSGNDTSSRIMPILSNRLCSSSLGNTVAISTVKTGHLASSVLISTTQPVVSPKCLTSAL
QIPVTVALPTPATTSPKIINTVPHSAAVPGATRSVSISKRQSRTSLQFHSPGISTTVPTN
VNTNKPQTELSSLSTSPGKITNTSNFASLPNQQALVKTPSYSSAPGGTTIHTASAPSNVT
SLVGSQFSEPCIQQKIVINTSTPLAPGTQIMINGTRFIVPPQGLGAGSHVLLISTNPKYG
APLVLNSGQGIQSTPIDNSAQKITLASNNSLSGQPLQHPLRSPTKFINSFGNASSIPTVH
TSPQLINTTAKVPVPPPVPTVSLTSVIKSPATLLAKTSLVSAICPSNPPLPSSTSVFHLD
PPVKKLLVSPEGAILNTINTPASKVSSLSPSLSQIVVSASRSPASVFPAFQSSGLEKPDR
AAS
NT seq 6312 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcccgggacgccgggagcgatggagccggctggggaggaagagcggccgcca
ccggcggccgaaggagaggacgacgaggaggaggtggcagcggcggcccagacctcaggg
ccggcccacggaaggagtgcctcctcgctggaggacgcggacgatcaggaggaagagatg
gaggcgatggtgatcggaggcggttgctgcaaggagcaggagctgacctacgagctacag
cagggctaccgcatcctgggcgagttcctgcaggagaagcaccggggcctcaccgccccc
tttctgcagcccttggggggcgttgccaccgcggaggaggaggtggcggaagggccgcgc
agcgggggccggggcggtcgcgccttcccgcagcagcccggacagggcatgtgtctgctg
cagatggaagagaagttcgccagcggccagtacgggggcatcaccgagttcgtggcggac
ttcaggttgatgctggagacgtgctaccgcctgcacggagtggaccactggatctccaaa
cagggccagaagctggagatgatgctggagcagaagttagcgcttctctctcggcacttg
agagaaaagacaacgatagcagttacatctagaggctattatggattggaggatgagaag
ggaactgcatgtacctcaacaaggcgtcggtcaacaccgcgaagtttggcaggcttgaca
agtggagtttttgaatctataatggttcaagttttgagacaggaagaacagctgagagca
aaagaagaaaaaaggcttcgggagcaggaaagaaaagaagcagaagaagctagtcaaaag
gaaatagaagaatgggaaagaaaacttctagctcaagcagctccaacttgtatggagacc
atgtgggaaattccagctattgggcatttcctttgtttagctcagcaaattctaaatttg
ccagaaatagtcttttacgaattggaacgttgtcttctgatgcctcagtgtaatgctttt
ctatcgaaaataatgacttctctattaagtcctccccatcgcagacctaccttacatcga
agacctactttgccttataggacctgggaagcagcgctgaggcagaaagtacaacagtgg
tacactgctgtagggcaaactgaaaatcctgataactgtgctgaaaaactggggttgtgt
cctcagttttttaaagttcttggagaagttaatccattggaagaaaaaccttttcacgaa
ctacctttttaccaaaaagtgtggctacttaagggtctttgtgactttgtgtatgaaaca
caaaaggaagttcaagatgctgtacttggacagcctatccatgaatgcagggaagttatt
cttggttatgattatttggagaatgcttatgtacattttccacagttctgtggtgcagat
gtacggatttataaacagagaccctttcaggccccagaatttccaattccacccattaaa
atacaaagagtacctcggattaaattggagaaattgaagtgtgactatgttagtacaagt
aatggagaacatagatgtagcagagatagcctgccctcttccttcaagaaagagcaggaa
aataattttgatccagcttgctgtcctgctaaaatgatcttggataatcatgacatctct
gttgaaatgggagtaaaatccaactatgaaattagaattcgcaggccttgtgaaattaaa
aaaactgattgttgtaaagaaaatttagagaaaccaaggagtccaggggaagttactggc
tttggagagcctcttagtccaggtgaaataaggtttatagaaaatcaggaaaaatacggt
gaagcttccagaataaagattgaacccagtccattaaaagaaaatactctaaaatcttgc
caaatacatgtaaatggaagtcacagtgatcatccagaaattaactgccacaaagttgta
agggatattctattagagcagtcactacagagccacaagaaactcaaactaactaaaatg
agggcaaaaaagaagaaaaagaaaaaaaagaaattgaaagatgttttgaatgaaaactta
cagagaaagcgtgaaggtcttcattctcttgcattcaagtcttacaaacctgagatccag
aataagttattgatcatcaaaaaaaaagcaaaacacaagaagcacaaatctggaaaaaaa
tccgtctctaaaaaagcaatcacaaagaagaggaaaactgtcataaagtcacctactgta
ccagagtttcagcttatttgcactaatcttgatgaactcagggaattaatcacaaaaatc
gagaatgaactcaaagatctggaaaacagtagaaaaaaatcgggaaaatggtatcatcgg
aggcaagctgtaaaagaattacatagtacattgatacgtcttttaaatgaattgctgcca
tgggaaccaaagttaatgaaggctttccaaagaaacaggagccgcctgaagaaagactat
gatgatttcagaagacaacctgatcatgatacatttaatagagaactatggaccactgat
gaaggtgaaggagatcttggaaaagactctcctaagggagaaatcagtaagtctatagac
tcaacagaacctctggatatcctggagaaagatcactttgattcagatgatatgaagttg
tcagaaatagattttcctatggctagaagcaagctgttgaaaaaggaattgccttcaaaa
gacttaccgaagacactgcttaaaacacttaaacgacagtccaaacaaactgattatgtg
gatgacagcacaaaagagctttctccaaggaagaaggcaaagttaagcacaaatgagaca
acagttgagaatctagaaagtgatgtgcagattgactgtttcagtgaatcaaagcataca
gagccatcatttccagagtcatttgcctcattggattcagtaccagtgtctactctccag
aaagggaccaaacccattcaggctttgcttgcaaagaatattgggaataaagtgacctta
acaaatcaactgcctccttccacaggtagaaatgctcttgctgtggaaaaaccagtttta
tctcctccggaagcaagcccgataaagccagcattgacctgccacaccaatacaaaaggt
cctttacaaatggtatacaaaatgccctgtggccagtggttgccaatagatcttcaaaat
agctctgtaaagattcaggtgcagcctatggtggatcctaaaacaggagaaaaaatcatg
cagcaagttcttattctgcctaagaattttgtgattcagcataaagaaggaaaagcagtt
gcaaaagaagtgccaccacttcaacagaaaggtacagaacaacattgttcatctttccca
cagacaacaaatataaattcttctttagcatcagtttttgtcaactcaccaggaactgtt
tctacccaactaccaaatacagctttcaacaaaacaattacacctttatcaaatataagt
agtgctagaccacagcctttgtcgcctgtaacctctgtaagtaacttattaacaccatca
gttaagactagccagagtgaggcaggaaaagccaagaatgcagtttcagcagccacattc
tccttgcccagtgcttcaccgaccatttcctccacaggtcagcctctgtcatcaacaaca
acactaaatgggtctacaaatcctggtagttccttcaactgttttgcacaacagactgct
gattcttctgaagcaaagcaagagctgaaaactgtgtgcataagagattcacagtcaatt
cttgttaggacacgaggtgggaacactggagttgtaaaagtacagaccaacccagatcaa
aattcacccaatactgtatcttcaagttcagttttcacttttgctcctcagctgcaggca
tttctggtgccaaaatcaacaacttcttcctctgctttttcacctgtagctggaacaact
actacatctagtctttcaccttttagccaaacaccaacttctgtttccattccagctagc
tttgccccatccatggggaaaaatctcaaacttacattaggccacaccactggcagtggt
gatttgggccacgtgatagataaaacttcacacatgccctcttctcccttgaagtcctct
atttgttctagtactctactaccatcaacaacaagtagttcggtaagtgtaattagcata
tcagcagcaaattttggacaaaacaatgcaaatattattcatactccaactaaacagcaa
caagtagattatatcacaaaaagttaccctgttacaaggtcagaagcaacagcagcaaca
aatggagatgtaatcagtgggactccagttcagaaacttatgctggtatcagctccatct
attctttcttctggcaatggaactgcaattaatatgacacctgcgctgacatctacaggt
gtttctgcccagaaattagtttttattaatgccccagttcctagtggtacatcaacccca
actcttgttgcagaatcattaaaacaaactcttcctcctccattgcataaagcatatgtt
aagactccagagcaaccccaaatagtactgattccgtctacagtgggcacaccaataaaa
ataaattcatcaccagctgtgtctcagataaaggatgtgaaaattggactaaacataggt
caagcaattgtaaatacttcaggcactgtgccagctataccatcaattaacatattacaa
aatgtaaccccaaaaggagaagacaaaagtagcaagggctatattttgccattgtcaaca
agtggtaattcagttccagtaagctcaaattttgtgagtcagaatattacccctgttaat
gaatcagtggtttcttcagcaagagcagtaaatgtgctttcagttaccggagcaaattta
tctttgggttcctttccagtgacctcagcctctgcttcagctggggcacaacctcctgtt
ttagtcagtggaaatgatacctcttcaagaattatgcctattttgtcaaatagactttgc
tcatcaagtctcggaaacactgtggctatatcaactgtgaaaacaggacaccttgcatca
tctgttctgatttcaactacacaaccagtagtgtctcctaaatgtttaacatcagctttg
caaattcctgttacggttgccttacctacacctgcgactacatcccctaaaataataaac
acagttccacattcggcagcagtaccaggagccacacgttctgtatctatttctaaaaga
caatctcggacttcactccagttccattcaccagggatttcaactacagtgccaacaaat
gtaaacacaaataaacctcaaactgaattgtcgtccctttcaacaagtccaggtaaaata
actaatacgtccaattttgcttctctgccaaatcagcaagctttagtaaaaacccccagt
tacagttctgctccaggtggcactaccattcacacggcttcggcaccatccaatgtaact
agtctagtcgggagtcagttcagtgaaccttgtattcagcaaaaaatagtcatcaatacc
agtacacctttggcacctggtactcagattatgattaacggaacccggtttattgttcca
ccacaaggtcttggagctggcagccatgttctccttatatctactaatccaaaatatgga
gcccccttagttcttaacagtggccaaggcattcaatctacaccaatagataactctgcc
cagaagatcacactagcatcaaataattccttaagtggccaacctctacaacatcctcta
agaagccctacaaaatttataaactcttttgggaatgcaagttctatacccacagtacat
acatcaccacaactcataaacacaactgctaaggttcctgttccacctcctgtaccaaca
gtatcactgacttcagtaattaagtctccagctactcttttggctaagacatctttggtt
tctgccatttgccccagtaatcctccactgccaagtagcacttcagtgtttcatttggac
ccacctgtcaaaaaattgttggttagcccagaaggagccattttgaataccataaatact
ccagcatctaaggtttcttcactctctccatctctctctcagattgttgtatctgccagt
cgaagtcctgcgtctgtcttccctgcttttcagtcgtcgggcttagagaagcctgacaga
gctgcatcttga

DBGET integrated database retrieval system