KEGG   Homo sapiens (human): 1584Help
Entry
1584              CDS       T01001                                 

Gene name
CYP11B1, CPN1, CYP11B, FHI, P450C11
Definition
cytochrome P450, family 11, subfamily B, polypeptide 1 (EC:1.14.15.4)
Orthology
K00497  
steroid 11beta-monooxygenase [EC:1.14.15.4]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Disease
H00216  
Congenital adrenal hyperplasia (CAH)
H00599  
46,XX disorders of sex development (Disorders related to androgen excess)
H00602  
Glucocorticoid-remediable aldosteronism (GRA)
Drug target
Metyrapone: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1584 (CYP11B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     1584 (CYP11B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP11 family
   1584 (CYP11B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q21
AA seq 503 aa AA seqDB search
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcatggcagtgccctggctgtccctgcaaagg
gcacaggcactgggcacgagagccgcccgggtccccaggacagtgctgccctttgaagcc
atgccccggcgtccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgaggacctgcacctggaagtacaccagaccttccaggaactagggcccattttcagg
tacgacttgggaggagcaggcatggtgtgtgtgatgctgccggaggacgtggagaagctg
caacaggtggacagcctgcatccccacaggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgctgaatgggcctgaatggcgcttcaac
cgattgcggctgaatccagaagtgctgtcgcccaacgctgtgcagaggttcctcccgatg
gtggatgcagtggccagggacttctcccaggccctgaagaagaaggtgctgcagaacgcc
cgggggagcctgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttggctctttttggagagcggctgggcctggttggccacagccccagttctgccagc
ctgaacttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggaccagccccaaggtgtggaaggagcactttgaggcctgg
gactgcatcttccagtacggcgacaactgtatccagaaaatctatcaggaactggccttc
agccgccctcaacagtacaccagcatcgtggcggagctcctgttgaatgcggaactgtcg
ccagatgccatcaaggccaactctatggaactcactgcagggagcgtggacacgacggtg
tttcccttgctgatgacgctctttgagctggctcggaaccccaacgtgcagcaggccctg
cgccaggagagcctggccgccgcagccagcatcagtgaacatccccagaaggcaaccacc
gagctgcccttgctgcgtgcggccctcaaggagaccttgcggctctaccctgtgggtctg
tttctggagcgagtggcgagctcagacttggtgcttcagaactaccacatcccagctggg
acattggtgcgcgtgttcctctactctctgggtcgcaaccccgccttgttcccgaggcct
gagcgctataacccccagcgctggctagacatcaggggctccggcaggaacttctaccac
gtgccctttggctttggcatgcgccagtgccttgggcggcgcctggcagaggcagagatg
ctgctgctgctgcaccatgtgctgaaacacctccaggtggagacactaacccaagaggac
ataaagatggtctacagcttcatattgaggcccagcatgttccccctcctcaccttcaga
gccatcaactaa

DBGET integrated database retrieval system