KEGG   Homo sapiens (human): 1585Help
Entry
1585              CDS       T01001                                 

Gene name
CYP11B2, ALDOS, CPN2, CYP11B, CYP11BL, CYPXIB2, P-450C18, P450C18, P450aldo
Definition
(RefSeq) cytochrome P450 family 11 subfamily B member 2
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04925  Aldosterone synthesis and secretion
Module
hsa_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
hsa_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Network
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00339  Aldosterone biosynthesis
Disease
H00258  Aldosterone synthase deficiency
H00602  Glucocorticoid-remediable aldosteronism (GRA)
H01633  High blood pressure
Drug target
Osilodrostat (DG02839): D11061
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1585 (CYP11B2)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    1585 (CYP11B2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     1585 (CYP11B2)
    1.14.15.5  corticosterone 18-monooxygenase
     1585 (CYP11B2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP11 family
   1585 (CYP11B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1585
NCBI-ProteinID: NP_000489
OMIM: 124080
HGNC: 2592
Ensembl: ENSG00000179142
Vega: OTTHUMG00000160254
Pharos: P19099(Tchem)
UniProt: P19099
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 503 aa AA seqDB search
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPGTSPLLTFRAIN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcgtggcagcgccctggctgtccctgcaaagg
gcacgggcactgggcactagagccgctcgggcccctaggacggtgctgccgtttgaagcc
atgccccagcatccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgagcacctgcacctggagatgcaccagaccttccaggagctggggcccattttcagg
tacaacttgggaggaccacgcatggtgtgtgtgatgctgccggaggatgtggagaagctg
caacaggtggacagcctgcatccctgcaggatgatcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgttgaatgggcctgaatggcgcttcaac
cgattgcggctgaacccagatgtgctgtcgcccaaggccgtgcagaggttcctcccgatg
gtggatgcagtggccagggacttctcccaggccctgaagaagaaggtgctgcagaacgcc
cgggggagcctgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttagctctttttggagagcggctgggcctggttggccacagccccagttctgccagc
ctgaacttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggatcagccccaaggtgtggaaggagcactttgaggcctgg
gactgcatcttccagtacggtgacaactgtatccagaaaatctaccaggaactggccttc
aaccgccctcaacactacacaggcatcgtggcggagctcctgttgaaggcggaactgtca
ctagaagccatcaaggccaactctatggaactcactgcagggagcgtggacacgacagcg
tttcccttgctgatgacgctctttgagctggctcggaaccccgacgtgcagcagatcctg
cgccaggagagcctggccgccgcagccagcatcagtgaacatccccagaaggcaaccacc
gagctgcccttgctgcgggcggccctcaaggagaccttgcggctctaccctgtgggtctg
tttttggagcgagtggtgagctcagacttggtgcttcagaactaccacatcccagctggg
acattggtacaggttttcctctactcgctgggtcgcaatgccgccttgttcccgaggcct
gagcggtataatccccagcgctggctagacatcaggggctccggcaggaacttccaccac
gtgccctttggctttggcatgcgccagtgcctcgggcggcgcctggcagaggcagagatg
ctgctgctgctgcaccacgtgctgaagcacttcctggtggagacactaactcaagaggac
ataaagatggtctacagcttcatattgaggcctggcacgtcccccctcctcactttcaga
gcgattaactag

DBGET integrated database retrieval system