KEGG   Homo sapiens (human): 1586Help
Entry
1586              CDS       T01001                                 

Gene name
CYP17A1, CPT7, CYP17, P450C17, S17AH
Definition
cytochrome P450, family 17, subfamily A, polypeptide 1 (EC:1.14.99.9 4.1.2.30)
Orthology
K00512  
steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone aldolase [EC:1.14.99.9 4.1.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Prolactin signaling pathway
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Disease
H00216  
Congenital adrenal hyperplasia (CAH)
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
Drug target
Ketoconazole: 
Mitotane: 
Abiraterone: 
Other: 
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.3
AA seq 508 aa AA seqDB search
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVIS
LICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRN
DLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIP
KVVFLIDSFKVKIKVRQAWREAQAEGST
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagctcgtggctctcttgctgcttaccctagcttatttgttttggcccaagaga
aggtgccctggtgccaagtaccccaagagcctcctgtccctgcccctggtgggcagcctg
ccattcctccccagacacggccatatgcataacaacttcttcaagctgcagaaaaaatat
ggccccatctattcggttcgtatgggcaccaagactacagtgattgtcggccaccaccag
ctggccaaggaggtgcttattaagaagggcaaggacttctctgggcggcctcaaatggca
actctagacatcgcgtccaacaaccgtaagggtatcgccttcgctgactctggcgcacac
tggcagctgcatcgaaggctggcgatggccacctttgccctgttcaaggatggcgatcag
aagctggagaagatcatttgtcaggaaatcagtacattgtgtgatatgctggccacccac
aacggacagtccatagacatctcctttcctgtcttcgtggcggtaaccaatgtcatctcc
ttgatctgcttcaatacctcctacaagaatggggaccctgagttgaatgtcatacagaat
tacaatgaaggcatcatagacaacctgagcaaagacagcctggtggacctagtcccctgg
ttgaagattttccccaacaaaaccctggaaaaattaaagagccatgttaaaatacgaaat
gatctgctgaataaaatacttgaaaattacaaggagaaattccggagtgactctatcacc
aacatgctggacacactgatgcaagccaagatgaactcagataatggcaatgctggccca
gatcaagactcagagctgctttcagataaccacattctcaccaccataggggacatcttt
ggggctggcgtggagaccaccacctctgtggttaaatggaccctggccttcctgctgcac
aatcctcaggtgaagaagaagctctacgaggagattgaccagaatgtgggtttcagccgc
acaccaactatcagtgaccgtaaccgtctcctcctgctggaggccaccatccgagaggtg
cttcgcctcaggcccgtggcccctatgctcatcccccacaaggccaacgttgactccagc
atcggtgagtttgctgtggacaagggcacagaagttatcatcaatctgtgggcgctgcat
cacaatgagaaggagtggcaccagccggatcagttcatgcctgagcgtttcttgaatcca
gcggggacccagctcatctcaccgtcagtaagctatttgcccttcggagcaggacctcgc
tcctgtataggtgagatcctggcccgccaggagctcttcctcatcatggcctggctgctg
cagaggttcgacctggaggtgccagatgatgggcagctgccctccctggaaggcatcccc
aaggtggtctttctgatcgactctttcaaagtgaagatcaaggtgcgccaggcctggagg
gaagcccaggctgagggtagcacctaa

DBGET integrated database retrieval system