KEGG   Homo sapiens (human): 1586Help
Entry
1586              CDS       T01001                                 

Gene name
CYP17A1, CPT7, CYP17, P450C17, S17AH
Definition
(RefSeq) cytochrome P450 family 17 subfamily A member 1 (EC:1.14.99.9 4.1.2.30)
  KO
K00512  
steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone aldolase [EC:1.14.14.19 4.1.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Prolactin signaling pathway
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Disease
H00216  
Congenital adrenal hyperplasia (CAH)
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
Drug target
Ketoconazole: 
Mitotane: 
Abiraterone: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1586 (CYP17A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    1586 (CYP17A1)
   04917 Prolactin signaling pathway
    1586 (CYP17A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.19  steroid 17alpha-monooxygenase
     1586 (CYP17A1)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.30  17alpha-hydroxyprogesterone aldolase
     1586 (CYP17A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP17 family
   1586 (CYP17A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.3
AA seq 508 aa AA seqDB search
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVIS
LICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRN
DLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIP
KVVFLIDSFKVKIKVRQAWREAQAEGST
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagctcgtggctctcttgctgcttaccctagcttatttgttttggcccaagaga
aggtgccctggtgccaagtaccccaagagcctcctgtccctgcccctggtgggcagcctg
ccattcctccccagacacggccatatgcataacaacttcttcaagctgcagaaaaaatat
ggccccatctattcggttcgtatgggcaccaagactacagtgattgtcggccaccaccag
ctggccaaggaggtgcttattaagaagggcaaggacttctctgggcggcctcaaatggca
actctagacatcgcgtccaacaaccgtaagggtatcgccttcgctgactctggcgcacac
tggcagctgcatcgaaggctggcgatggccacctttgccctgttcaaggatggcgatcag
aagctggagaagatcatttgtcaggaaatcagtacattgtgtgatatgctggccacccac
aacggacagtccatagacatctcctttcctgtcttcgtggcggtaaccaatgtcatctcc
ttgatctgcttcaatacctcctacaagaatggggaccctgagttgaatgtcatacagaat
tacaatgaaggcatcatagacaacctgagcaaagacagcctggtggacctagtcccctgg
ttgaagattttccccaacaaaaccctggaaaaattaaagagccatgttaaaatacgaaat
gatctgctgaataaaatacttgaaaattacaaggagaaattccggagtgactctatcacc
aacatgctggacacactgatgcaagccaagatgaactcagataatggcaatgctggccca
gatcaagactcagagctgctttcagataaccacattctcaccaccataggggacatcttt
ggggctggcgtggagaccaccacctctgtggttaaatggaccctggccttcctgctgcac
aatcctcaggtgaagaagaagctctacgaggagattgaccagaatgtgggtttcagccgc
acaccaactatcagtgaccgtaaccgtctcctcctgctggaggccaccatccgagaggtg
cttcgcctcaggcccgtggcccctatgctcatcccccacaaggccaacgttgactccagc
atcggtgagtttgctgtggacaagggcacagaagttatcatcaatctgtgggcgctgcat
cacaatgagaaggagtggcaccagccggatcagttcatgcctgagcgtttcttgaatcca
gcggggacccagctcatctcaccgtcagtaagctatttgcccttcggagcaggacctcgc
tcctgtataggtgagatcctggcccgccaggagctcttcctcatcatggcctggctgctg
cagaggttcgacctggaggtgccagatgatgggcagctgccctccctggaaggcatcccc
aaggtggtctttctgatcgactctttcaaagtgaagatcaaggtgcgccaggcctggagg
gaagcccaggctgagggtagcacctaa

DBGET integrated database retrieval system