KEGG   Homo sapiens (human): 1588Help
Entry
1588              CDS       T01001                                 

Gene name
CYP19A1, ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Disease
H00599  
46,XX disorders of sex development (Disorders related to androgen excess)
H00794  
Aromatase excess syndrome
Drug target
Aminoglutethimide: 
Formestane: 
Anastrozole: 
Letrozole: 
Vorozole: 
Exemestane: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1588 (CYP19A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    1588 (CYP19A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     1588 (CYP19A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP19 family
   1588 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q21.1
AA seq 503 aa AA seqDB search
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttttggaaatgctgaacccgatacattataacatcaccagcatcgtgcctgaagcc
atgcctgctgccaccatgccagtcctgctcctcactggcctttttctcttggtgtggaat
tatgagggcacatcctcaataccaggtcctggctactgcatgggaattggacccctcatc
tcccacggcagattcctgtggatggggatcggcagtgcctgcaactactacaaccgggta
tatggagaattcatgcgagtctggatctctggagaggaaacactcattatcagcaagtcc
tcaagtatgttccacataatgaagcacaatcattacagctctcgattcggcagcaaactt
gggctgcagtgcatcggtatgcatgagaaaggcatcatatttaacaacaatccagagctc
tggaaaacaactcgacccttctttatgaaagctctgtcaggccccggccttgttcgtatg
gtcacagtctgtgctgaatccctcaaaacacatctggacaggttggaggaggtgaccaat
gaatcgggctatgtggacgtgttgacccttctgcgtcgtgtcatgctggacacctctaac
acgctcttcttgaggatccctttggacgaaagtgctatcgtggttaaaatccaaggttat
tttgatgcatggcaagctctcctcatcaaaccagacatcttctttaagatttcttggcta
tacaaaaagtatgagaagtctgtcaaggatttgaaagatgccatagaagttctgatagca
gaaaaaagacgcaggatttccacagaagagaaactggaagaatgtatggactttgccact
gagttgattttagcagagaaacgtggtgacctgacaagagagaatgtgaaccagtgcata
ttggaaatgctgatcgcagctcctgacaccatgtctgtctctttgttcttcatgctattt
ctcattgcaaagcaccctaatgttgaagaggcaataataaaggaaatccagactgttatt
ggtgagagagacataaagattgatgatatacaaaaattaaaagtgatggaaaacttcatt
tatgagagcatgcggtaccagcctgtcgtggacttggtcatgcgcaaagccttagaagat
gatgtaatcgatggctacccagtgaaaaaggggacaaacattatcctgaatattggaagg
atgcacagactcgagtttttccccaaacccaatgaatttactcttgaaaattttgcaaag
aatgttccttataggtactttcagccatttggctttgggccccgtggctgtgcaggaaag
tacatcgccatggtgatgatgaaagccatcctcgttacacttctgagacgattccacgtg
aagacattgcaaggacagtgtgttgagagcatacagaagatacacgacttgtccttgcac
ccagatgagactaaaaacatgctggaaatgatctttaccccaagaaactcagacaggtgt
ctggaacactag

DBGET integrated database retrieval system