KEGG   Homo sapiens (human): 1588Help
Entry
1588              CDS       T01001                                 

Gene name
CYP19A1, ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM
Definition
(RefSeq) cytochrome P450 family 19 subfamily A member 1
  KO
K07434  aromatase [EC:1.14.14.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
Module
hsa_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Disease
H00599  46,XX disorders of sex development (Disorders related to androgen excess)
H00794  Aromatase excess syndrome
H02020  Aromatase deficiency
Drug target
Aminoglutethimide: D00574
Anastrozole: D00960
Exemestane: D00963
Fadrozole (DG01292): D02451 D03778 D07940
Formestane: D07260
Letrozole: D00964
Liarozole (DG01293): D03781 D03784
Plomestane: D03749
Testolactone: D00153
Vorozole: D03786
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1588 (CYP19A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    1588 (CYP19A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     1588 (CYP19A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP19 family
   1588 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF5432
Motif
Other DBs
NCBI-GeneID: 1588
NCBI-ProteinID: NP_000094
OMIM: 107910
HGNC: 2594
Ensembl: ENSG00000137869
Vega: OTTHUMG00000131747
Pharos: P11511(Tclin)
UniProt: P11511 A0A024R5S8 Q8TCA4 Q8IYG4
Structure
PDB: 

Jmol
Position
15q21.2
AA seq 503 aa AA seqDB search
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttttggaaatgctgaacccgatacattataacatcaccagcatcgtgcctgaagcc
atgcctgctgccaccatgccagtcctgctcctcactggcctttttctcttggtgtggaat
tatgagggcacatcctcaataccaggtcctggctactgcatgggaattggacccctcatc
tcccacggcagattcctgtggatggggatcggcagtgcctgcaactactacaaccgggta
tatggagaattcatgcgagtctggatctctggagaggaaacactcattatcagcaagtcc
tcaagtatgttccacataatgaagcacaatcattacagctctcgattcggcagcaaactt
gggctgcagtgcatcggtatgcatgagaaaggcatcatatttaacaacaatccagagctc
tggaaaacaactcgacccttctttatgaaagctctgtcaggccccggccttgttcgtatg
gtcacagtctgtgctgaatccctcaaaacacatctggacaggttggaggaggtgaccaat
gaatcgggctatgtggacgtgttgacccttctgcgtcgtgtcatgctggacacctctaac
acgctcttcttgaggatccctttggacgaaagtgctatcgtggttaaaatccaaggttat
tttgatgcatggcaagctctcctcatcaaaccagacatcttctttaagatttcttggcta
tacaaaaagtatgagaagtctgtcaaggatttgaaagatgccatagaagttctgatagca
gaaaaaagacgcaggatttccacagaagagaaactggaagaatgtatggactttgccact
gagttgattttagcagagaaacgtggtgacctgacaagagagaatgtgaaccagtgcata
ttggaaatgctgatcgcagctcctgacaccatgtctgtctctttgttcttcatgctattt
ctcattgcaaagcaccctaatgttgaagaggcaataataaaggaaatccagactgttatt
ggtgagagagacataaagattgatgatatacaaaaattaaaagtgatggaaaacttcatt
tatgagagcatgcggtaccagcctgtcgtggacttggtcatgcgcaaagccttagaagat
gatgtaatcgatggctacccagtgaaaaaggggacaaacattatcctgaatattggaagg
atgcacagactcgagtttttccccaaacccaatgaatttactcttgaaaattttgcaaag
aatgttccttataggtactttcagccatttggctttgggccccgtggctgtgcaggaaag
tacatcgccatggtgatgatgaaagccatcctcgttacacttctgagacgattccacgtg
aagacattgcaaggacagtgtgttgagagcatacagaagatacacgacttgtccttgcac
ccagatgagactaaaaacatgctggaaatgatctttaccccaagaaactcagacaggtgt
ctggaacactag

DBGET integrated database retrieval system