KEGG   Homo sapiens (human): 1588Help
Entry
1588              CDS       T01001                                 

Gene name
CYP19A1, ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Disease
H00599  
46,XX disorders of sex development (Disorders related to androgen excess)
H00794  
Aromatase excess syndrome
Drug target
Aminoglutethimide: 
Formestane: 
Anastrozole: 
Letrozole: 
Vorozole: 
Exemestane: 
Other: 
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q21.1
AA seq 503 aa AA seqDB search
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttttggaaatgctgaacccgatacattataacatcaccagcatcgtgcctgaagcc
atgcctgctgccaccatgccagtcctgctcctcactggcctttttctcttggtgtggaat
tatgagggcacatcctcaataccaggtcctggctactgcatgggaattggacccctcatc
tcccacggcagattcctgtggatggggatcggcagtgcctgcaactactacaaccgggta
tatggagaattcatgcgagtctggatctctggagaggaaacactcattatcagcaagtcc
tcaagtatgttccacataatgaagcacaatcattacagctctcgattcggcagcaaactt
gggctgcagtgcatcggtatgcatgagaaaggcatcatatttaacaacaatccagagctc
tggaaaacaactcgacccttctttatgaaagctctgtcaggccccggccttgttcgtatg
gtcacagtctgtgctgaatccctcaaaacacatctggacaggttggaggaggtgaccaat
gaatcgggctatgtggacgtgttgacccttctgcgtcgtgtcatgctggacacctctaac
acgctcttcttgaggatccctttggacgaaagtgctatcgtggttaaaatccaaggttat
tttgatgcatggcaagctctcctcatcaaaccagacatcttctttaagatttcttggcta
tacaaaaagtatgagaagtctgtcaaggatttgaaagatgccatagaagttctgatagca
gaaaaaagacgcaggatttccacagaagagaaactggaagaatgtatggactttgccact
gagttgattttagcagagaaacgtggtgacctgacaagagagaatgtgaaccagtgcata
ttggaaatgctgatcgcagctcctgacaccatgtctgtctctttgttcttcatgctattt
ctcattgcaaagcaccctaatgttgaagaggcaataataaaggaaatccagactgttatt
ggtgagagagacataaagattgatgatatacaaaaattaaaagtgatggaaaacttcatt
tatgagagcatgcggtaccagcctgtcgtggacttggtcatgcgcaaagccttagaagat
gatgtaatcgatggctacccagtgaaaaaggggacaaacattatcctgaatattggaagg
atgcacagactcgagtttttccccaaacccaatgaatttactcttgaaaattttgcaaag
aatgttccttataggtactttcagccatttggctttgggccccgtggctgtgcaggaaag
tacatcgccatggtgatgatgaaagccatcctcgttacacttctgagacgattccacgtg
aagacattgcaaggacagtgtgttgagagcatacagaagatacacgacttgtccttgcac
ccagatgagactaaaaacatgctggaaatgatctttaccccaagaaactcagacaggtgt
ctggaacactag

DBGET integrated database retrieval system