KEGG   Homo sapiens (human): 158835Help
Entry
158835            CDS       T01001                                 

Gene name
AWAT2, ARAT, DC4, DGAT2L4, MFAT, WS
Definition
acyl-CoA wax alcohol acyltransferase 2 (EC:2.3.1.75 2.3.1.76)
Orthology
K11156  
diacylglycerol O-acyltransferase 2-like protein 4 [EC:2.3.1.75 2.3.1.76]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    158835 (AWAT2)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    158835 (AWAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     158835 (AWAT2)
    2.3.1.76  retinol O-fatty-acyltransferase
     158835 (AWAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq13.1
AA seq 333 aa AA seqDB search
MLLPSKKDLKTALDVFAVFQWSFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDW
KTPQRGGRRFTCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHF
ATEASGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLTHKGTGNMV
IVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGG
FVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIV
AKYHTLYIDALRKLFDQHKTKFGISETQELEII
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgccctctaagaaggacctcaagactgccctggatgtctttgctgttttccag
tggtccttcagtgccttgcttatcacaaccactgtgattgctgtcaacctctacctggtg
gtgttcacaccatactggcctgtcactgtgcttattcttacctggctggcttttgactgg
aagacccctcagcgaggcggccgccggtttacctgtgtgaggcactggcgcctgtggaaa
cactacagcgattatttccctctcaagcttctgaagactcatgacatctgccccagccgc
aactacatcctcgtctgccaccctcatgggctctttgcccatggatggtttggccacttt
gccacagaggcctcaggcttctccaagatatttcctggcatcaccccttacatactcaca
ctgggagcctttttctggatgcctttcctcagagaatatgtaatgtctacaggggcctgc
tctgtgagtcgatcctccattgactttctgctgactcataaaggcacaggcaacatggtc
attgtggtgattggtggactggctgagtgcagatacagcctgccaggttcttctaccctg
gtgttgaagaaccggtctggctttgtgcgcatggcccttcagcatggggtgcctctaata
cctgcctatgcctttggggagacggacctctatgatcagcacattttcactcctggtggc
tttgtcaaccgcttccagaagtggttccagagcatggtacacatctacccttgtgctttc
tatggacgtggcttcaccaagaactcctggggccttctgccctatagtcggcctgtaacc
accatcgtcggggagcctctaccaatgcccaagattgagaatccaagccaggagatcgtg
gctaaatatcacacactctatattgatgccctacgtaaactgtttgaccagcataagacc
aagtttggtatctcagagacccaggagctggagataatttga

DBGET integrated database retrieval system