KEGG   Homo sapiens (human): 158835Help
Entry
158835            CDS       T01001                                 

Gene name
AWAT2, ARAT, DC4, DGAT2L4, MFAT, WS
Definition
acyl-CoA wax alcohol acyltransferase 2 (EC:2.3.1.75 2.3.1.76)
Orthology
K11156  
diacylglycerol O-acyltransferase 2-like protein 4 [EC:2.3.1.75 2.3.1.76]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Vitamin digestion and absorption
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq13.1
AA seq 333 aa AA seqDB search
MLLPSKKDLKTALDVFAVFQWSFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDW
KTPQRGGRRFTCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHF
ATEASGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLTHKGTGNMV
IVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGG
FVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIV
AKYHTLYIDALRKLFDQHKTKFGISETQELEII
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgccctctaagaaggacctcaagactgccctggatgtctttgctgttttccag
tggtccttcagtgccttgcttatcacaaccactgtgattgctgtcaacctctacctggtg
gtgttcacaccatactggcctgtcactgtgcttattcttacctggctggcttttgactgg
aagacccctcagcgaggcggccgccggtttacctgtgtgaggcactggcgcctgtggaaa
cactacagcgattatttccctctcaagcttctgaagactcatgacatctgccccagccgc
aactacatcctcgtctgccaccctcatgggctctttgcccatggatggtttggccacttt
gccacagaggcctcaggcttctccaagatatttcctggcatcaccccttacatactcaca
ctgggagcctttttctggatgcctttcctcagagaatatgtaatgtctacaggggcctgc
tctgtgagtcgatcctccattgactttctgctgactcataaaggcacaggcaacatggtc
attgtggtgattggtggactggctgagtgcagatacagcctgccaggttcttctaccctg
gtgttgaagaaccggtctggctttgtgcgcatggcccttcagcatggggtgcctctaata
cctgcctatgcctttggggagacggacctctatgatcagcacattttcactcctggtggc
tttgtcaaccgcttccagaagtggttccagagcatggtacacatctacccttgtgctttc
tatggacgtggcttcaccaagaactcctggggccttctgccctatagtcggcctgtaacc
accatcgtcggggagcctctaccaatgcccaagattgagaatccaagccaggagatcgtg
gctaaatatcacacactctatattgatgccctacgtaaactgtttgaccagcataagacc
aagtttggtatctcagagacccaggagctggagataatttga

DBGET integrated database retrieval system