KEGG   Homo sapiens (human): 158880Help
Entry
158880            CDS       T01001                                 

Gene name
USP51
Definition
ubiquitin specific peptidase 51 (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     158880 (USP51)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   158880 (USP51)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     158880 (USP51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.21
AA seq 711 aa AA seqDB search
MAQVRETSLPSGSGVRWISGGGGGASPEEAVEKAGKMEEAAAGATKASSRREAEEMKLEP
LQEREPAPEENLTWSSSGGDEKVLPSIPLRCHSSSSPVCPRRKPRPRPQPRARSRSQPGL
SAPPPPPARPPPPPPPPPPPAPRPRAWRGSRRRSRPGSRPQTRRSCSGDLDGSGDPGGLG
DWLLEVEFGQGPTGCSHVESFKVGKNWQKNLRLIYQRFVWSGTPETRKRKAKSCICHVCS
THMNRLHSCLSCVFFGCFTEKHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDKDIEQI
AKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQSTCETKEQEPKLVKPKKKRRKKSVYTV
GLRGLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYS
GSRTPHIPYKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSGGQEANNPNCC
NCIIDQIFTGGLQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFDSQNPERADSTVSRD
DHIPGIPSLTDCLQWFTRPEHLGSSAKIKCNSCQSYQESTKQLTMKKLPIVACFHLKRFE
HVGKQRRKINTFISFPLELDMTPFLASTKESRMKEGQPPTDCVPNENKYSLFAVINHHGT
LESGHYTSFIRQQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHKQGLEKD
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggttcgagaaacttctttgccctccggctctggggtccgctggatctccgga
ggtgggggaggagcctctcctgaggaggcggttgagaaggcggggaaaatggaggaggcg
gcggcgggggctacgaaggcgtcttcgagacgtgaagccgaggagatgaagctggagcca
ttacaagagcgtgagcccgcgccggaggagaacttgacgtggagcagcagcggcggcgac
gagaaggtgctcccttcaatcccccttcgctgtcacagcagctcctcgcccgtttgcccg
cgccgcaagccccgccctcggccccagccccgggcccgctcccgcagccagcctgggctc
tcggccccacccccgcctccagcccggcccccgcccccgccgccacccccgcccccaccc
gcaccgcggcccagggcctggcgtggatcccggcgcagatcccggcctgggtccaggcct
cagacacggagaagctgctctggtgacctagacgggtcgggggatcctggcggcttaggg
gactggttgctggaggtcgagtttggtcagggtcccacaggctgctctcatgtggagagc
tttaaagtaggtaagaactggcagaagaacctgaggttgatctaccagcgtttcgtttgg
agtgggaccccagagactaggaaacgtaaagcaaagtcatgcatctgtcacgtatgtagt
acccatatgaacagactccactcttgtctctcctgtgtcttttttggctgcttcactgag
aaacatattcacaaacatgcagaaacaaagcagcaccatttagctgtagacctttatcat
ggggtcatatattgcttcatgtgtaaggattatgtatatgacaaagacatagaacagatt
gccaaagaaacaaaagaaaaaattttgagattattaacttccacctcaacagatgtttct
catcaacagtttatgacatcagggtttgaagacaagcaatcaacctgtgagacaaaggaa
caggagccaaaattggtgaaacccaagaaaaagagaagaaaaaagtcagtctatactgta
ggcctgagagggctaatcaatcttgggaacacttgttttatgaattgtattgtccaggca
cttacccatattcctctactgaaagatttcttcctctctgacaagcacaaatgtataatg
acaagccccagcttgtgtctggtctgtgaaatgtcttcgctttttcatgctatgtactct
gggagccgaactcctcacattccctataagttactgcatctgatatggatccatgcagaa
catttagcagggtacaggcagcaggatgcccatgagttccttattgcaatattagacgtg
ctacatagacacagcaaagatgatagtggtgggcaggaggccaataaccccaactgctgt
aactgcatcatagaccaaatctttacaggtggcctgcaatcagatgtcacatgtcaagcc
tgccatagtgtttctaccaccatagacccatgctgggacatcagtttggacttgcctggc
tcttgtgccacattcgattcccagaacccagagagggctgacagcacagtgagcagggat
gaccacataccaggaatcccctcacttacagactgtctacagtggtttacaaggccagag
cacctaggaagcagtgccaaaatcaaatgcaatagttgccaaagctaccaggagtctact
aaacagctcacaatgaaaaaattacccattgtggcttgttttcatctcaagcggtttgag
catgtaggcaaacagaggcgaaagattaatacctttatctcctttcccttggagctggac
atgactccgtttttggcctctactaaagagagcagaatgaaagaaggccagccaccaaca
gattgtgtgcccaatgagaataagtattccttgtttgcagtgattaatcaccatggaact
ttggaaagtggccactataccagcttcatccggcaacaaaaggaccagtggttcagctgt
gatgatgccatcatcaccaaggctaccattgaggacttactctacagtgaagggtattta
ctgttctatcacaaacagggtctagagaaagactag

DBGET integrated database retrieval system