KEGG   Homo sapiens (human): 158983Help
Entry
158983            CDS       T01001                                 

Gene name
H2BFWT
Definition
H2B histone family, member W, testis-specific
Orthology
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22.2
AA seq 175 aa AA seqDB search
MLRTEVPRLPRSTTAIVWSCHLMATASAMAGPSSETTSEEQLITQEPKEANSTTSQKQSK
QRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATE
AGHLARSTKRQTITAWETRMAVRLLLPGQMGKLAESEGTKAVLRTSLYAIQQQRK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtaccgaagtgccccggcttccccggtccacaaccgccattgtctggtcgtgc
catctaatggccactgcctccgccatggctggaccttcctctgagacgacctctgaggaa
cagctgatcacccaggagcccaaagaggccaactccactacgtcccagaagcagagcaag
cagaggaagcgagggcgccatgggccccgcaggtgccactccaactgccgcggggacagc
ttcgccacctatttccgccgggtgctgaagcaggttcaccagggcctcagcctttcccgg
gaggccgtgagtgtcatggattctttggttcatgacatattggaccgcatcgccaccgag
gctggtcacctggcccgctccaccaagcgccagaccatcactgcctgggagacccggatg
gctgtgcgcctgctgctgccggggcagatgggcaagctcgccgagtccgaaggcacgaag
gctgtcctcagaacttcactgtatgccatacagcaacagagaaagtga

DBGET integrated database retrieval system