KEGG   Homo sapiens (human): 158983Help
Entry
158983            CDS       T01001                                 

Gene name
H2BFWT
Definition
(RefSeq) H2B histone family member W, testis specific
  KO
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    158983 (H2BFWT)
  Immune diseases
   05322 Systemic lupus erythematosus
    158983 (H2BFWT)
  Substance dependence
   05034 Alcoholism
    158983 (H2BFWT)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    158983 (H2BFWT)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   158983 (H2BFWT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22.2
AA seq 175 aa AA seqDB search
MLRTEVPRLPRSTTAIVWSCHLMATASAMAGPSSETTSEEQLITQEPKEANSTTSQKQSK
QRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATE
AGHLARSTKRQTITAWETRMAVRLLLPGQMGKLAESEGTKAVLRTSLYAIQQQRK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtaccgaagtgccccggcttccccggtccacaaccgccattgtctggtcgtgc
catctaatggccactgcctccgccatggctggaccttcctctgagacgacctctgaggaa
cagctgatcacccaggagcccaaagaggccaactccactacgtcccagaagcagagcaag
cagaggaagcgagggcgccatgggccccgcaggtgccactccaactgccgcggggacagc
ttcgccacctatttccgccgggtgctgaagcaggttcaccagggcctcagcctttcccgg
gaggccgtgagtgtcatggattctttggttcatgacatattggaccgcatcgccaccgag
gctggtcacctggcccgctccaccaagcgccagaccatcactgcctgggagacccggatg
gctgtgcgcctgctgctgccggggcagatgggcaagctcgccgagtccgaaggcacgaag
gctgtcctcagaacttcactgtatgccatacagcaacagagaaagtga

DBGET integrated database retrieval system