KEGG   Homo sapiens (human): 159Help
Entry
159               CDS       T01001                                 

Gene name
ADSS, ADEH, ADSS_2
Definition
(RefSeq) adenylosuccinate synthase
  KO
K01939  
adenylosuccinate synthase [EC:6.3.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    159 (ADSS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    159 (ADSS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     159 (ADSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q44
AA seq 456 aa AA seqDB search
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgccgagacctacccggcggcatcctccctgcccaacggcgattgcggccgc
cccagggcgcggcccggaggaaaccgggtgacggtggtgctcggtgcgcagtggggcgac
gaaggcaaagggaaggtggtggacctgctggcgcaggacgccgacatcgtgtgccgctgc
cagggaggaaataatgctggccatacagttgttgtggattctgtggaatatgattttcat
ctcttacccagtggaataattaatccaaatgtcactgcattcattggaaatggtgtggta
attcatctacctggattgtttgaagaagcagagaaaaatgttcaaaaaggaaaaggacta
gaaggctgggaaaaaaggcttattatatctgacagagctcatattgtatttgattttcat
caagcagctgatggtatccaggaacaacagagacaagaacaagcaggaaaaaatttgggt
acaacaaaaaagggcattggcccagtttattcgtccaaagctgctcggagtggactcagg
atgtgcgaccttgtttctgactttgatggcttctctgagaggtttaaagttctagctaac
caatacaaatctatataccccactttggaaatagacattgaaggtgaattacaaaaactc
aagggttatatggaaaagattaaaccaatggtgagagatggagtttattttctatatgag
gccctacatggaccaccaaagaaaatcttggtagaaggtgcaaatgcagcactattagat
attgattttgggacttacccttttgtaacctcttcaaattgtactgttggaggtgtttgt
actggtttgggtatgccacctcaaaatgttggagaagtgtatggagttgtgaaagcttat
acaactagagttggtattggtgcctttcctacagagcaagacaatgaaattggagaatta
ttacaaacaaggggtagagagtttggtgtaactactggaaggaaaagaagatgtggctgg
ttggacctcgttttgctcaaatatgctcatatgatcaatggatttactgcgttggcactt
accaagttggatattttggacatgtttacggaaatcaaagttggagttgcttacaagtta
gatggtgaaatcatacctcatatcccagcaaaccaagaagtcttaaataaagttgaagtt
caatataagactctcccaggatggaacacagacatatcaaatgcaagggcgtttaaagaa
ctacctgttaatgcacaaaactatgttcgatttattgaagatgagcttcaaattccagtt
aagtggattggtgttggtaaatccagagaatctatgattcaactcttttaa

DBGET integrated database retrieval system