KEGG   Homo sapiens (human): 1591Help
Entry
1591              CDS       T01001                                 

Gene name
CYP24A1, CP24, CYP24, HCAI, HCINF1, P450-CC24
Definition
(RefSeq) cytochrome P450 family 24 subfamily A member 1
  KO
K07436  
vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
MicroRNAs in cancer
Disease
H01371  
Hypercalcemia infantile
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    1591 (CYP24A1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    1591 (CYP24A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     1591 (CYP24A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP24 family
   1591 (CYP24A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q07973(Tchem)
UniProt: 
Position
20q13.2
AA seq 514 aa AA seqDB search
MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPG
PTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYR
TESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKIN
EVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIM
AIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSAD
FLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVL
PENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIV
RKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccccatcagcaagagccgctcgcttgccgccttcctgcagcagctgcgcagt
ccgaggcagcccccgagactggtgacatctacggcgtacacgtcccctcagccgcgagag
gtgccagtctgcccgctgacagctggtggcgagactcagaacgcggccgccctgccgggc
cccaccagctggccactgctgggcagcctgctgcagattctctggaaagggggtctcaag
aaacagcacgacaccctggtggagtaccacaagaagtatggcaagattttccgcatgaag
ttgggttcctttgagtcggtgcacctgggctcgccatgcctgctggaagcgctgtaccgc
accgagagcgcgtacccgcagcggctggagatcaaaccgtggaaggcctatcgcgactac
cgcaaagaaggctacgggctgctgatcctggaaggggaagactggcagcgggtccggagt
gcctttcaaaagaaactaatgaaaccaggggaagtgatgaagctggacaacaaaatcaat
gaggtcttggccgattttatgggcagaatagatgagctctgtgatgaaagaggccacgtt
gaagacttgtacagcgaactgaacaaatggtcgtttgaaagtatctgcctcgtgttgtat
gagaagagatttgggcttctccagaagaatgcaggggatgaagctgtgaacttcatcatg
gccatcaaaacaatgatgagcacgtttgggaggatgatggtcactccagtcgagctgcac
aagagcctcaacaccaaggtctggcaggaccacactctggcctgggacaccattttcaaa
tcagtcaaagcttgtatcgacaaccggttagagaagtattctcagcagcctagtgcagat
ttcctttgtgacatttatcaccagaatcggctttcaaagaaagaattgtatgctgctgtc
acagagctccagctggctgcggtggaaacgacagcaaacagtctaatgtggattctctac
aatttatcccgtaatccccaagtgcaacaaaagcttcttaaggaaattcaaagtgtatta
cctgagaatcaggtgccacgggcagaagatttgaggaatatgccgtatttaaaagcctgt
ctgaaagaatctatgaggcttacgccgagtgtaccatttacaactcggactcttgacaag
gcaacagttctgggtgaatatgctttacccaaaggaacagtgctcatgctaaatacccag
gtgttgggatccagtgaagacaattttgaagattcaagtcagtttagacctgaacgttgg
cttcaggagaaggaaaaaattaatccttttgcgcatcttccatttggcgttggaaaaaga
atgtgcattggtcgccgattagcagagcttcaactgcatttggctctttgttggattgtc
cgcaaatacgacatccaggccacagacaatgagcctgttgagatgctacactcaggcacc
ctggtgcccagccgggaactccccatcgcgttttgccagcgataa

DBGET integrated database retrieval system