KEGG   Homo sapiens (human): 1592Help
Entry
1592              CDS       T01001                                 

Gene name
CYP26A1, CP26, CYP26, P450RAI, P450RAI1
Definition
(RefSeq) cytochrome P450 family 26 subfamily A member 1 (EC:1.14.-.-)
  KO
K07437  
cytochrome P450, family 26, subfamily A
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Drug target
Talarozole: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1592 (CYP26A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP26 family
   1592 (CYP26A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q23-q24
AA seq 497 aa AA seqDB search
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggggctcccggcgctgctggccagtgcgctctgcaccttcgtgctgccgctgctgctc
ttcctggctgcgatcaagctctgggacctgtactgcgtgagcggccgcgaccgcagttgt
gccctcccattgccccccgggactatgggcttccccttctttggggaaaccttgcagatg
gtactgcagcggaggaagttcctgcagatgaagcgcaggaaatacggcttcatctacaag
acgcatctgttcgggcggcccaccgtacgggtgatgggcgcggacaatgtgcggcgcatc
ttgctcggagagcaccggctggtgtcggtccactggccagcgtcggtgcgcaccattctg
ggatctggctgcctctctaacctgcacgactcctcgcacaagcagcgcaagaaggtgatt
atgcgggccttcagccgcgaggcactcgaatgctacgtgccggtgatcaccgaggaagtg
ggcagcagcctggagcagtggctgagctgcggcgagcgcggcctcctggtctaccccgag
gtgaagcgcctcatgttccgaatcgccatgcgcatcctactgggctgcgaaccccaactg
gcgggcgacggggactccgagcagcagcttgtggaggccttcgaggaaatgacccgcaat
ctcttctcgctgcccatcgacgtgcccttcagcgggctgtaccggggcatgaaggcgcgg
aacctcattcacgcgcgcatcgagcagaacattcgcgccaagatctgcgggctgcgggca
tccgaggcgggccagggctgcaaagacgcgctgcagctgttgatcgagcactcgtgggag
aggggagagcggctggacatgcaggcactaaagcaatcttcaaccgaactcctctttgga
ggacacgaaaccacggccagtgcagccacatctctgatcacttacctggggctctaccca
catgttctccagaaagtgcgagaagagctgaagagtaagggtttactttgcaagagcaat
caagacaacaagttggacatggaaattttggaacaacttaaatacatcgggtgtgttatt
aaggagacccttcgactgaatcccccagttccaggagggtttcgggttgctctgaagact
tttgaattaaatggataccagattcccaagggctggaatgttatctacagtatctgtgat
actcatgatgtggcagagatcttcaccaacaaggaagaatttaatcctgaccgattcatg
ctgcctcacccagaggatgcatccaggttcagcttcattccatttggaggaggccttagg
agctgtgtaggcaaagaatttgcaaaaattcttctcaaaatatttacagtggagctggcc
aggcattgtgactggcagcttctaaatggacctcctacaatgaaaaccagtcccaccgtg
tatcctgtggacaatctccctgcaagattcacccatttccatggggaaatctga

DBGET integrated database retrieval system