KEGG   Homo sapiens (human): 1593Help
Entry
1593              CDS       T01001                                 

Gene name
CYP27A1, CP27, CTX, CYP27
Definition
cytochrome P450, family 27, subfamily A, polypeptide 1 (EC:1.14.13.15)
Orthology
K00488  
cholestanetriol 26-monooxygenase [EC:1.14.13.15]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
PPAR signaling pathway
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Disease
H00151  
Cerebrotendinous xanthomatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    1593 (CYP27A1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    1593 (CYP27A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.15  cholestanetriol 26-monooxygenase
     1593 (CYP27A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP27 family
   1593 (CYP27A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 531 aa AA seqDB search
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEI
PRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQ
EGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNE
VIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTF
VRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAA
GPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEA
LHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPK
NTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRR
IAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctgggctgcgcgaggctgaggtgggcgctgcgaggggccggccgtggcctc
tgcccccacggggccagagccaaggccgcgatccctgccgccctcccctcggacaaggcc
accggagctcccggagccgggcctggtgtccggcggcggcaacggagcttagaggagatt
ccacgtctaggacagctgcgcttcttctttcagctgttcgttcaaggctatgccctgcaa
ctgcaccagttacaggtgctttacaaggccaagtacggtccaatgtggatgtcctactta
gggcctcagatgcacgtgaacctggccagtgccccgctcttggagcaagtgatgcggcaa
gagggcaagtacccagtacggaacgacatggagctatggaaggagcaccgggaccagcac
gacctgacctatgggccgttcaccacggaaggacaccactggtaccagctgcgccaggct
ctgaaccagcggttgctgaagccagcggaagcagcgctctatacggatgctttcaatgag
gtgattgatgactttatgactcgactggaccagctgcgggcagagagtgcttcggggaac
caggtgtcggacatggctcaactcttctactactttgccttggaagctatttgctacatc
ctgttcgagaaacgcattggctgcctgcagcgatccatccccgaggacaccgtgaccttc
gtcagatccatcgggttaatgttccagaactcactctatgccaccttcctccccaagtgg
actcgccccgtgctgcctttctggaagcgatacctggatggttggaatgccatcttttcc
tttgggaagaagctgattgatgagaagctcgaagatatggaggcccaactgcaggcagca
gggccagatggcatccaggtgtctggctacctgcacttcttactggccagtggacagctc
agtcctcgggaggccatgggcagcctgcctgagctgctcatggctggagtggacacgaca
tccaacacgctgacatgggccctgtaccacctctcaaaggaccctgagatccaggaggcc
ttgcacgaggaagtggtgggtgtggtgccagccgggcaagtgccccagcacaaggacttt
gcccacatgccgttgctcaaagctgtgcttaaggagactctgcgtctctaccctgtggtc
cccacaaactcccggatcatagaaaaggaaattgaagttgatggcttcctcttccccaag
aacacccagtttgtgttctgccactatgtggtgtcccgggaccccactgccttctctgag
cctgaaagcttccagccccaccgctggctgagaaacagccagcctgctacccccaggatc
cagcacccatttggctctgtgccctttggctatggggtccgggcctgcctgggccgcagg
attgcagagctggagatgcagctactcctcgcaaggctgatccagaagtacaaggtggtc
ctggccccggagacgggggagttgaagagtgtggcccgcattgtcctggttcccaataag
aaagtgggcctgcagttcctgcagagacagtgctga

DBGET integrated database retrieval system