KEGG   Homo sapiens (human): 1593Help
Entry
1593              CDS       T01001                                 

Gene name
CYP27A1, CP27, CTX, CYP27
Definition
cytochrome P450, family 27, subfamily A, polypeptide 1 (EC:1.14.13.15)
Orthology
K00488  
cholestanetriol 26-monooxygenase [EC:1.14.13.15]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
PPAR signaling pathway
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Disease
H00151  
Cerebrotendinous xanthomatosis
Class
Metabolism; Lipid metabolism; Primary bile acid biosynthesis [PATH:hsa00120]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 531 aa AA seqDB search
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEI
PRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQ
EGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNE
VIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTF
VRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAA
GPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEA
LHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPK
NTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRR
IAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctgggctgcgcgaggctgaggtgggcgctgcgaggggccggccgtggcctc
tgcccccacggggccagagccaaggccgcgatccctgccgccctcccctcggacaaggcc
accggagctcccggagccgggcctggtgtccggcggcggcaacggagcttagaggagatt
ccacgtctaggacagctgcgcttcttctttcagctgttcgttcaaggctatgccctgcaa
ctgcaccagttacaggtgctttacaaggccaagtacggtccaatgtggatgtcctactta
gggcctcagatgcacgtgaacctggccagtgccccgctcttggagcaagtgatgcggcaa
gagggcaagtacccagtacggaacgacatggagctatggaaggagcaccgggaccagcac
gacctgacctatgggccgttcaccacggaaggacaccactggtaccagctgcgccaggct
ctgaaccagcggttgctgaagccagcggaagcagcgctctatacggatgctttcaatgag
gtgattgatgactttatgactcgactggaccagctgcgggcagagagtgcttcggggaac
caggtgtcggacatggctcaactcttctactactttgccttggaagctatttgctacatc
ctgttcgagaaacgcattggctgcctgcagcgatccatccccgaggacaccgtgaccttc
gtcagatccatcgggttaatgttccagaactcactctatgccaccttcctccccaagtgg
actcgccccgtgctgcctttctggaagcgatacctggatggttggaatgccatcttttcc
tttgggaagaagctgattgatgagaagctcgaagatatggaggcccaactgcaggcagca
gggccagatggcatccaggtgtctggctacctgcacttcttactggccagtggacagctc
agtcctcgggaggccatgggcagcctgcctgagctgctcatggctggagtggacacgaca
tccaacacgctgacatgggccctgtaccacctctcaaaggaccctgagatccaggaggcc
ttgcacgaggaagtggtgggtgtggtgccagccgggcaagtgccccagcacaaggacttt
gcccacatgccgttgctcaaagctgtgcttaaggagactctgcgtctctaccctgtggtc
cccacaaactcccggatcatagaaaaggaaattgaagttgatggcttcctcttccccaag
aacacccagtttgtgttctgccactatgtggtgtcccgggaccccactgccttctctgag
cctgaaagcttccagccccaccgctggctgagaaacagccagcctgctacccccaggatc
cagcacccatttggctctgtgccctttggctatggggtccgggcctgcctgggccgcagg
attgcagagctggagatgcagctactcctcgcaaggctgatccagaagtacaaggtggtc
ctggccccggagacgggggagttgaagagtgtggcccgcattgtcctggttcccaataag
aaagtgggcctgcagttcctgcagagacagtgctga

DBGET integrated database retrieval system