KEGG   Homo sapiens (human): 1593Help
Entry
1593              CDS       T01001                                 

Gene name
CYP27A1, CP27, CTX, CYP27
Definition
(RefSeq) cytochrome P450 family 27 subfamily A member 1 (EC:1.14.13.15)
  KO
K00488  
cholestanetriol 26-monooxygenase [EC:1.14.15.15]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
PPAR signaling pathway
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Disease
H00151  
Cerebrotendinous xanthomatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    1593 (CYP27A1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    1593 (CYP27A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.15  cholestanetriol 26-monooxygenase
     1593 (CYP27A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP27 family
   1593 (CYP27A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 531 aa AA seqDB search
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEI
PRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQ
EGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNE
VIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTF
VRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAA
GPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEA
LHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPK
NTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRR
IAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctgggctgcgcgaggctgaggtgggcgctgcgaggggccggccgtggcctc
tgcccccacggggccagagccaaggccgcgatccctgccgccctcccctcggacaaggcc
accggagctcccggagccgggcctggtgtccggcggcggcaacggagcttagaggagatt
ccacgtctaggacagctgcgcttcttctttcagctgttcgttcaaggctatgccctgcaa
ctgcaccagttacaggtgctttacaaggccaagtacggtccaatgtggatgtcctactta
gggcctcagatgcacgtgaacctggccagtgccccgctcttggagcaagtgatgcggcaa
gagggcaagtacccagtacggaacgacatggagctatggaaggagcaccgggaccagcac
gacctgacctatgggccgttcaccacggaaggacaccactggtaccagctgcgccaggct
ctgaaccagcggttgctgaagccagcggaagcagcgctctatacggatgctttcaatgag
gtgattgatgactttatgactcgactggaccagctgcgggcagagagtgcttcggggaac
caggtgtcggacatggctcaactcttctactactttgccttggaagctatttgctacatc
ctgttcgagaaacgcattggctgcctgcagcgatccatccccgaggacaccgtgaccttc
gtcagatccatcgggttaatgttccagaactcactctatgccaccttcctccccaagtgg
actcgccccgtgctgcctttctggaagcgatacctggatggttggaatgccatcttttcc
tttgggaagaagctgattgatgagaagctcgaagatatggaggcccaactgcaggcagca
gggccagatggcatccaggtgtctggctacctgcacttcttactggccagtggacagctc
agtcctcgggaggccatgggcagcctgcctgagctgctcatggctggagtggacacgaca
tccaacacgctgacatgggccctgtaccacctctcaaaggaccctgagatccaggaggcc
ttgcacgaggaagtggtgggtgtggtgccagccgggcaagtgccccagcacaaggacttt
gcccacatgccgttgctcaaagctgtgcttaaggagactctgcgtctctaccctgtggtc
cccacaaactcccggatcatagaaaaggaaattgaagttgatggcttcctcttccccaag
aacacccagtttgtgttctgccactatgtggtgtcccgggaccccactgccttctctgag
cctgaaagcttccagccccaccgctggctgagaaacagccagcctgctacccccaggatc
cagcacccatttggctctgtgccctttggctatggggtccgggcctgcctgggccgcagg
attgcagagctggagatgcagctactcctcgcaaggctgatccagaagtacaaggtggtc
ctggccccggagacgggggagttgaagagtgtggcccgcattgtcctggttcccaataag
aaagtgggcctgcagttcctgcagagacagtgctga

DBGET integrated database retrieval system