KEGG   Homo sapiens (human): 16Help
Entry
16                CDS       T01001                                 

Gene name
AARS, CMT2N, EIEE29
Definition
(RefSeq) alanyl-tRNA synthetase (EC:6.1.1.7)
  KO
K01872  
alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    16 (AARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     16 (AARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   16 (AARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    16 (AARS)
 Prokaryotic Type
    16 (AARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22
AA seq 968 aa AA seqDB search
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIERLYVTYFGGDEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEV
TDDSPKYNYHLDSSGSYVFENTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRP
IMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAK
VKAQTAPNKDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKR
VLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggactctactctaacagcaagtgaaatccggcagcgatttatagatttcttcaagagg
aacgagcatacgtatgttcactcgtctgccaccatcccattggatgaccccactttgctc
tttgccaatgcaggcatgaaccagtttaaacccattttcctgaacacaattgacccatct
caccccatggcaaagctgagcagagctgccaatacccagaagtgcatccgggctgggggc
aaacataatgacctggacgatgtgggcaaggatgtctatcatcacaccttcttcgagatg
ctgggctcttggtcttttggagattactttaaggaattggcatgtaagatggctctggaa
ctcctcacccaagagtttggcattcccattgaaagactttatgttacttactttggcggg
gatgaagcagctggcttagaagcagatctggaatgcaaacagatctggcaaaatttgggg
ctggatgacaccaaaatcctcccaggcaacatgaaggataacttctgggagatgggtgac
acgggcccctgtggtccttgcagtgagatccactacgaccggattggtggtcgggacgcc
gcacatcttgtcaaccaggacgaccctaatgtgctggagatctggaaccttgtgttcatc
cagtataacagggaagctgatggcattctgaaacctcttcccaagaaaagcattgacaca
gggatgggcctggaacgactggtatctgtgctgcagaataagatgtccaactatgacact
gacctttttgtcccttactttgaagccattcagaagggcacaggtgcccgaccatacact
gggaaagttggtgctgaggatgccgatgggattgacatggcctaccgggtgctggctgac
cacgctcggaccatcactgtggcactggctgatggtggccggcctgacaacacagggcgt
ggatatgtgttgagacggattctccgccgagctgtccgatacgcccatgaaaagctcaat
gccagcaggggcttctttgctacgttagtggatgttgtcgtccagtccctgggagatgca
tttcctgagctgaagaaggacccagacatggtgaaggacatcattaatgaagaagaggtg
cagtttctcaagactctcagcagagggcgtcgcatcctggacaggaaaattcagagcctg
ggagacagcaagaccattcccggagacactgcttggctcctctatgacacctatgggttt
ccagtggatctgactggactgattgctgaagagaagggcctggtggtagacatggatggc
tttgaagaggagaggaaactggcccagctgaaatcacagggcaagggagctggtggggaa
gacctcattatgctggacatttacgctatcgaagagctccgggcacggggtctggaggtc
acagatgattccccaaagtacaattaccatttggactccagtggtagctatgtatttgag
aacacagtggctacggtgatggctctgcgcagggagaagatgttcgtggaagaggtgtcc
acaggccaggagtgtggagtggtgctggacaagacctgtttctatgctgagcaaggaggc
cagatctatgacgaaggctacctggtgaaggtggatgacagcagtgaagataaaacagag
tttacagtgaagaatgctcaggtccgaggagggtatgtgctacacattggaaccatctac
ggtgacctgaaagtgggggatcaggtctggctgtttattgatgagccccgacgaagaccc
atcatgagcaaccacacagctacgcacattctgaacttcgccctgcgctcagtgcttggg
gaagctgaccagaaaggctcattggttgctcctgaccgcctcagatttgactttactgcc
aagggagccatgtccacccaacagatcaagaaggctgaagagattgctaatgagatgatt
gaggcagccaaggccgtctatacccaggattgccccctggcagcagcgaaagccatccag
ggcctacgggctgtgtttgatgagacctatcctgaccctgtgcgagtcgtctccattggg
gtcccggtgtccgagttgctggatgacccctctgggcctgctggctccctgacttctgtt
gagttctgtgggggaacgcacctgcggaactcgagtcatgcaggagcttttgtgatcgtg
acggaagaagccattgccaagggtatccggaggattgtggctgtcacaggtgccgaggcc
cagaaggccctcaggaaagcagagagcttgaagaaatgtctctctgtcatggaagccaaa
gtgaaggctcagactgctccaaacaaggatgtgcagagggagatcgctgaccttggagag
gccctggccactgcagtcatcccccagtggcagaaggatgaattgcgggagactctcaaa
tccctaaagaaggtcatggatgacttggaccgagccagcaaagccgatgtccagaaacga
gtgttagagaagacgaagcagttcatcgacagcaaccccaaccagcctcttgtcatcctg
gagatggagagcggcgcctcagccaaggccctgaatgaagccttgaagctcttcaagatg
cactcccctcagacttctgccatgctcttcacggtggacaatgaggctggcaagatcacg
tgcctgtgtcaagttccccagaatgcagccaatcggggcttaaaagccagcgagtgggtg
cagcaggtgtcaggcttgatggacggtaaaggtggtggcaaggatgtgtctgcacaggcc
acaggcaagaacgttggctgcctgcaggaggcgctgcagctggccacttccttcgcccag
ctgcgcctcggggatgtaaagaactga

DBGET integrated database retrieval system