KEGG   Homo sapiens (human): 1601Help
Entry
1601              CDS       T01001                                 

Gene name
DAB2, DOC-2, DOC2
Definition
(RefSeq) DAB2, clathrin adaptor protein
  KO
K12475  
disabled homolog 2
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1601 (DAB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    1601 (DAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P98082(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5p13.1
AA seq 770 aa AA seqDB search
MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDV
PDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNK
ISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKK
KIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLN
SEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPF
TQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQ
AGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQ
PNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGF
SQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFP
APAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQL
RQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPR
QVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgaagtagaaacaagtgcaaccaatggtcagcccgaccaacaggccgcacca
aaagcaccctcaaagaaggaaaaaaagaaaggccctgaaaagacagatgaatatctctta
gcaaggttcaaaggcgatggtgtaaaatataaggccaagctgattggcattgatgatgtg
ccagatgcaagaggggataaaatgagccaagactctatgatgaaactaaagggaatggcg
gcagctggtcggtctcagggacaacacaaacaaaggatctgggtcaacatttccctttct
gggataaaaataattgatgagaaaactggggtaatagagcatgaacatccagtaaataag
atttctttcattgcccgtgatgtgacagacaaccgggcatttggttacgtgtgtggagga
gaaggccagcatcagttttttgccataaaaaccgggcaacaggctgaaccattagttgtt
gatcttaaagacctttttcaagttatctataatgtaaagaaaaaggaagaagaaaagaaa
aagatagaggaagccagcaaagcagttgagaatgggagtgaggccctaatgattctagat
gaccaaactaacaaactgaaatcgggtgttgaccagatggatttgtttggggacatgtct
acacctcctgacctaaatagtccaacagaaagcaaagatatcctgttagtggatctaaac
tctgaaatcgacaccaatcagaattctttaagagaaaatccattcttaacaaacggcatc
acctcctgttctcttcctcgaccaacgcctcaggcatccttcttgcctgaaaatgccttt
tctgccaatctcaacttctttcccacccctaatcctgatcctttccgtgacgatcctttc
acacagccagaccaatcgacaccttcttcgtttgattctctcaaatctccagatcagaag
aaagagaattcgagtagctcgtctactccgctgagtaatgggcccctgaatggtgatgtt
gactactttggtcagcaatttgaccagatctctaaccggactggcaaacaggaagctcag
gcaggcccatggcccttttcaagttcgcaaacccagccagcagtgagaactcaaaatggg
gtatctgaaagagaacagaacggcttctctgtcaaatcctccccgaacccttttgtggga
agccctcccaaaggactgtccatacagaatggcgtaaagcaggacttggaaagctctgtc
cagtcctcaccacatgactccatagccattatcccacctccacaaagtaccaaaccagga
agaggcagaaggactgctaagtcttcagccaatgacttgcttgcatcagacatctttgct
cctcccgtctcagaaccttcaggccaggcgtcacccacaggacaacctacagccctgcag
cccaaccctctggatctcttcaaaacaagtgctcctgccccagtggggcccctggtgggt
ctaggtggtgtaactgtcacactccctcaggcaggaccatggaacacagcatctttggtc
ttcaatcagtccccttcaatggctccgggagccatgatgggtggtcaaccttcaggtttt
agtcagcccgtcatttttggtacaagtccagctgtttcaggttggaaccagccttcaccc
tttgcagcctcaactccccctccagtgcctgttgtctggggcccttctgcatctgtggca
cccaatgcttggtcaacaacaagccctttggggaatccttttcagagcaatatttttcca
gctcctgctgtgtccactcagcccccatccatgcactcctctctcctggtcactcctcct
cagccacctcccagagctggccctcccaaggacatctccagtgatgccttcactgcctta
gacccacttggggataaagagatcaaggatgtgaaagaaatgtttaaggatttccaactg
cggcagccacctgctgtgcccgcgcggaagggagagcagacttcttctgggactttgagt
gcctttgccagttatttcaacagcaaggttggcattcctcaggagaatgcagaccatgat
gactttgatgctaatcaactattgaacaagatcaatgaaccaccaaagccagctcccaga
caagtttccctgccagttaccaaatctactgacaatgcatttgagaaccctttctttaaa
gattcttttggttcatcacaagcctctgtggcttcttctcaacctgtatcttctgagatg
tatagggatccatttggaaatccttttgcctaa

DBGET integrated database retrieval system