KEGG   Homo sapiens (human): 1601Help
Entry
1601              CDS       T01001                                 

Gene name
DAB2, DOC-2, DOC2
Definition
Dab, mitogen-responsive phosphoprotein, homolog 2 (Drosophila)
Orthology
K12475  
disabled homolog 2
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13.1
AA seq 749 aa AA seqDB search
MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDV
PDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNK
ISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKK
KIEEASKAVENGSEALMILDDQTNKLKSESKDILLVDLNSEIDTNQNSLRENPFLTNGIT
SCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKK
ENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQAGPWPFSSSQTQPAVRTQNGV
SEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSVQSSPHDSIAIIPPPQSTKPGR
GRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTSAPAPVGPLVGL
GGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSPF
AASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQ
PPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSA
FASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKD
SFGSSQASVASSQPVSSEMYRDPFGNPFA
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgaagtagaaacaagtgcaaccaatggtcagcccgaccaacaggccgcacca
aaagcaccctcaaagaaggaaaaaaagaaaggccctgaaaagacagatgaatatctctta
gcaaggttcaaaggcgatggtgtaaaatataaggccaagctgattggcattgatgatgtg
ccagatgcaagaggggataaaatgagccaagactctatgatgaaactaaagggaatggcg
gcagctggtcggtctcagggacaacacaaacaaaggatctgggtcaacatttccctttct
gggataaaaataattgatgagaaaactggggtaatagagcatgaacatccagtaaataag
atttctttcattgcccgtgatgtgacagacaaccgggcatttggttacgtgtgtggagga
gaaggccagcatcagttttttgccataaaaaccgggcaacaggctgaaccattagttgtt
gatcttaaagacctttttcaagttatctataatgtaaagaaaaaggaagaagaaaagaaa
aagatagaggaagccagcaaagcagttgagaatgggagtgaggccctaatgattctagat
gaccaaactaacaaactgaaatcggaaagcaaagatatcctgttagtggatctaaactct
gaaatcgacaccaatcagaattctttaagagaaaatccattcttaacaaacggcatcacc
tcctgttctcttcctcgaccaacgcctcaggcatccttcttgcctgaaaatgccttttct
gccaatctcaacttctttcccacccctaatcctgatcctttccgtgacgatcctttcaca
cagccagaccaatcgacaccttcttcgtttgattctctcaaatctccagatcagaagaaa
gagaattcgagtagctcgtctactccgctgagtaatgggcccctgaatggtgatgttgac
tactttggtcagcaatttgaccagatctctaaccggactggcaaacaggaagctcaggca
ggcccatggcccttttcaagttcgcaaacccagccagcagtgagaactcaaaatggggta
tctgaaagagaacagaacggcttctctgtcaaatcctccccgaacccttttgtgggaagc
cctcccaaaggactgtccatacagaatggcgtaaagcaggacttggaaagctctgtccag
tcctcaccacatgactccatagccattatcccacctccacaaagtaccaaaccaggaaga
ggcagaaggactgctaagtcttcagccaatgacttgcttgcatcagacatctttgctcct
cccgtctcagaaccttcaggccaggcgtcacccacaggacaacctacagccctgcagccc
aaccctctggatctcttcaaaacaagtgctcctgccccagtggggcccctggtgggtcta
ggtggtgtaactgtcacactccctcaggcaggaccatggaacacagcatctttggtcttc
aatcagtccccttcaatggctccgggagccatgatgggtggtcaaccttcaggttttagt
cagcccgtcatttttggtacaagtccagctgtttcaggttggaaccagccttcacccttt
gcagcctcaactccccctccagtgcctgttgtctggggcccttctgcatctgtggcaccc
aatgcttggtcaacaacaagccctttggggaatccttttcagagcaatatttttccagct
cctgctgtgtccactcagcccccatccatgcactcctctctcctggtcactcctcctcag
ccacctcccagagctggccctcccaaggacatctccagtgatgccttcactgccttagac
ccacttggggataaagagatcaaggatgtgaaagaaatgtttaaggatttccaactgcgg
cagccacctgctgtgcccgcgcggaagggagagcagacttcttctgggactttgagtgcc
tttgccagttatttcaacagcaaggttggcattcctcaggagaatgcagaccatgatgac
tttgatgctaatcaactattgaacaagatcaatgaaccaccaaagccagctcccagacaa
gtttccctgccagttaccaaatctactgacaatgcatttgagaaccctttctttaaagat
tcttttggttcatcacaagcctctgtggcttcttctcaacctgtatcttctgagatgtat
agggatccatttggaaatccttttgcctaa

DBGET integrated database retrieval system