KEGG   Homo sapiens (human): 1605Help
Entry
1605              CDS       T01001                                 

Gene name
DAG1, 156DAG, A3a, AGRNR, DAG, MDDGC7, MDDGC9
Definition
dystroglycan 1 (dystrophin-associated glycoprotein 1)
Orthology
K06265  
dystroglycan 1
Organism
hsa  Homo sapiens (human)
Pathway
ECM-receptor interaction
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00593  
Limb-girdle muscular dystrophy (LGMD)
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21
AA seq 895 aa AA seqDB search
MRMSVGLSLLLPLWGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGL
PLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSITVTGSGSCRHLQFIP
VVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtctgtgggcctctcgctgctgctgcccctctgggggaggacctttctcctc
ctgctctctgtggttatggctcagtcccactggcccagtgaaccctcagaggctgtcagg
gactgggaaaaccagcttgaggcatccatgcactcagtgctctcagacctccacgaggct
gttcccacagtggttggcattcctgatggcacggctgtcgtcgggcgctcatttcgagtg
accattccaacagatttgattgcctccagtggagatatcatcaaggtatcagcggcaggg
aaggaggctttgccatcttggctgcactgggactcacagagccacaccctggagggcctc
ccccttgacactgataagggtgtgcattacatttcagtgagcgctacacggctgggggcc
aacgggagccacatcccccagacctccagtgtgttctccatcgaggtctaccctgaagac
cacagtgagctgcagtcggtgaggacagcctccccagaccctggtgaggtggtatcatct
gcctgtgctgcggatgaacctgtgactgttttgacggtgattttggatgccgacctcacc
aagatgaccccaaagcaaaggattgacctcctgcacaggatgcggagcttctcagaagta
gagcttcacaacatgaaattagtgccggtggtgaataacagactatttgacatgtcggcc
ttcatggctggcccgggaaatgcaaaaaaggtggtggagaatggggcccttctctcctgg
aagctgggctgctccctgaaccagaacagtgtgcctgacattcatggtgtagaggcccct
gccagggagggcgcaatgtctgctcagcttggctaccctgtggtgggttggcacatcgcc
aataagaagccccctcttcccaaacgcgtccggaggcagatccatgctacacccacacct
gtcactgccattgggcccccaaccacggctatccaggagcccccatccaggatcgtgcca
acccccacatctccagccattgctcctccaacagagaccatggctcctccagtcagggat
cctgttcctgggaaacccacggtcaccatccggactcgaggcgccattattcaaacccca
accctaggccccatccagcctactcgggtgtcagaagctggcaccacagttcctggccag
attcgcccaacgatgaccattcctggctatgtggagcctactgcagttgctacccctccc
acaaccaccaccaagaagccacgagtatccacaccaaaaccagcaacgccttcaactgac
tccaccaccaccacgactcgcaggccaaccaagaaaccacggacaccccggccagtgccc
cgggtcaccaccaaagtttccatcaccagattggaaactgcctcaccgcctactcgtatt
cgcaccaccaccagtggagtgccccgtggcggagaacccaaccagcgcccagagctcaag
aaccatattgacagggtagatgcctgggttggcacctactttgaggtgaagatcccgtca
gacactttctatgaccatgaggacaccaccactgacaagctgaagctgaccctgaaactg
cgggagcagcagctggtgggcgagaagtcctgggtacagttcaacagcaacagccagctc
atgtatggccttcccgacagcagccacgtgggcaaacacgagtatttcatgcatgccaca
gacaaggggggcctgtcggctgtggatgccttcgagatccacgtccacaggcgcccccaa
ggggatagggctcctgcaaggttcaaggccaagtttgtgggtgacccggcactggtgttg
aatgacatccacaagaagattgccttggtaaagaaactggccttcgcctttggagaccga
aactgtagcaccatcaccctgcagaatatcacccggggctccatcgtggtggaatggacc
aacaacacactgcccttggagccctgccccaaggagcagatcgctgggctgagccgccgg
atcgctgaggatgatggaaaacctcggcctgccttctccaacgccctagagcctgacttt
aaggccacaagcatcactgtgacgggctctggcagttgtcggcacctacagtttatccct
gtggtaccacccaggagagtgccctcagaggcgccgcccacagaagtgcctgacagggac
cctgagaagagcagtgaggatgatgtctacctgcacacagtcattccggccgtggtggtc
gcagccatcctgctcattgctggcatcattgccatgatctgctaccgcaagaagcggaag
ggcaagcttacccttgaggaccaggccaccttcatcaagaagggggtgcctatcatcttt
gcagacgaactggacgactccaagcccccaccctcctccagcatgccactcattctgcag
gaggagaaggctcccctaccccctcctgagtaccccaaccagagtgtgcccgagaccact
cctctgaaccaggacaccatgggagagtacacgcccctgcgggatgaggatcccaatgcg
cctccctaccagcccccaccgcccttcacagcacccatggagggcaagggctcccgtccc
aagaacatgaccccataccggtcacctcctccctatgtcccaccttaa

DBGET integrated database retrieval system