KEGG   Homo sapiens (human): 1606Help
Entry
1606              CDS       T01001                                 

Gene name
DGKA, DAGK, DAGK1, DGK-alpha
Definition
(RefSeq) diacylglycerol kinase, alpha 80kDa (EC:2.7.1.107)
  KO
K00901  
diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    1606 (DGKA)
   00564 Glycerophospholipid metabolism
    1606 (DGKA)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    1606 (DGKA)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    1606 (DGKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     1606 (DGKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 735 aa AA seqDB search
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQ
NLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL
NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSTNFFGFLS
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggagaggggcctaataagccccagtgattttgcccagctgcaaaaatacatg
gaatactccaccaaaaaggtcagtgatgtcctaaagctcttcgaggatggcgagatggct
aaatatgtccaaggagatgccattgggtacgagggattccagcaattcctgaaaatctat
ctcgaagtggataatgttcccagacacctaagcctggcactgtttcaatcctttgagact
ggtcactgcttaaatgagacaaatgtgacaaaagatgtggtgtgtctcaatgatgtttcc
tgctacttttcccttctggagggtggtcggccagaagacaagttagaattcaccttcaag
ctgtacgacacggacagaaatgggatcctggacagctcagaagtggacaaaattatccta
cagatgatgcgagtggctgaatacctggattgggatgtgtctgagctgaggccgattctt
caggagatgatgaaagagattgactatgatggcagtggctctgtctctcaagctgagtgg
gtccgggctggggccaccaccgtgccactgctagtgctgctgggtctggagatgactctg
aaggacgacggacagcacatgtggaggcccaagaggttccccagaccagtctactgcaat
ctgtgcgagtcaagcattggtcttggcaaacagggactgagctgtaacctctgtaagtac
actgttcacgaccagtgtgccatgaaagccctgccttgtgaagtcagcacctatgccaag
tctcggaaggacattggtgtccaatcacatgtgtgggtgcgaggaggctgtgagtccggg
cgctgcgaccgctgtcagaaaaagatccggatctaccacagtctgaccgggctgcattgt
gtatggtgccacctagagatccacgatgactgcctgcaagcggtgggccatgagtgtgac
tgtgggctgctccgggatcacatcctgcctccatcttccatctatcccagtgtcctggcc
tctggaccggatcgtaaaaatagcaaaacaagccagaagaccatggatgatttaaatttg
agcacctctgaggctctgcggattgaccctgttcctaacacccacccacttctcgtcttt
gtcaatcctaagagtggcgggaagcaggggcaaagggtgctctggaagttccagtatata
ttaaaccctcgacaggtgttcaacctcctaaaggatggtcctgagatagggctccgatta
ttcaaggatgttcctgatagccggattttggtgtgtggtggagacggcacagtaggctgg
attctagagaccattgacaaagctaacttgccagttttgcctcctgttgctgtgttgccc
ctgggtactggaaatgatctggctcgatgcctaagatggggaggaggttatgaaggacag
aatctggcaaagatcctcaaggatttagagatgagtaaagtggtacatatggatcgatgg
tctgtggaggtgatacctcaacaaactgaagaaaaaagtgacccagtcccctttcaaatc
atcaataactacttctctattggcgtggatgcctctattgctcatcgattccacatcatg
cgagagaaatatccggagaagttcaacagcagaatgaagaacaagctatggtacttcgaa
tttgccacatctgaatccatcttctcaacatgcaaaaagctggaggagtctttgacagtt
gagatctgtgggaaaccgctggatctgagcaacctgtccctagaaggcatcgcagtgcta
aacatccctagcatgcatggtggctccaacctctggggtgataccaggagaccccatggg
gatatctatgggatcaaccaggccttaggtgctacagctaaagtcatcaccgaccctgat
atcctgaaaacctgtgtaccagacctaagtgacaagagactggaagtggttgggctggag
ggtgcaattgagatgggccaaatctataccaagctcaagaatgctggacgtcggctggcc
aagtgctctgagatcaccttccacaccacaaaaacccttcccatgcaaattgacggagaa
ccctggatgcagacgccctgtacaatcaagatcacccacaagaaccagatgcccatgctc
atgggcccacccccccgctccaccaatttctttggcttcttgagctaa

DBGET integrated database retrieval system