KEGG   Homo sapiens (human): 1608Help
Entry
1608              CDS       T01001                                 

Gene name
DGKG, DAGK3, DGK-GAMMA
Definition
diacylglycerol kinase, gamma 90kDa (EC:2.7.1.107)
Orthology
K00901  
diacylglycerol kinase (ATP dependent) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    1608 (DGKG)
   00564 Glycerophospholipid metabolism
    1608 (DGKG)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    1608 (DGKG)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    1608 (DGKG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     1608 (DGKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q27.2-q27.3
AA seq 766 aa AA seqDB search
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMR
AYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEAC
APDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKL
EFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFV
SLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHIMLMGVRKQGL
CCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQS
VTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERLNFFRDTPDFRVLACGGDGTVGWILDCIDK
ANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSLTKILKDIEQSPLVMLDRWHLEVIPR
EEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETF
AATCKKLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKKNRAVIRESRK
GVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCASVTIRTNKLLP
MQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaacggtgggtctccctcactccagaagaatttgaccaactccagaaatat
tcagaatattcctccaagaagataaaagatgccttgactgaatttaatgagggtgggagc
ctcaaacaatatgacccacatgagccgattagctatgatgtcttcaagctgttcatgagg
gcgtacctggaggtggaccttccccagccactgagcactcacctcttcctggccttcagc
cagaagcccagacacgagacctctgaccacccgacggagggagccagcaacagtgaggcc
aacagcgcagatactaatatacagaatgcagataatgccaccaaagcagacgaggcctgt
gcccctgatactgaatcaaatatggctgagaagcaagcaccagctgaagaccaagtggct
gcgacccccctggaaccccccgtccctcggtcttcaagctcggaatccccagtggtatac
ctgaaggatgttgtgtgctacctgtccctgctggagacggggaggcctcaggataagctg
gagttcatgtttcgcctctatgattcagatgagaacggtctcctggaccaagcggagatg
gattgcattgtcaaccaaatgctgcatattgcccagtacctggagtgggatcccacagag
ctgaggcctatattgaaggagatgctgcaagggatggactacgaccgggacggctttgtg
tctctacaggaatgggtccatggagggatgaccaccatcccattgctggtcctcctgggg
atggatgactctggctccaagggggatgggcggcacgcctggaccatgaagcacttcaag
aaaccaacctactgcaacttctgccatatcatgctcatgggcgtccgcaagcaaggcctg
tgctgcacttactgtaaatacactgtccacgaacgctgtgtgtccagaaacattcctggt
tgtgtcaaaacgtactcaaaagccaaaaggagtggtgaggtgatgcagcacgcatgggtg
gaagggaactcctccgtcaagtgtgaccggtgccacaaaagtatcaagtgctaccagagt
gtcaccgcgcggcactgcgtgtggtgccggatgacgtttcaccgcaaatgtgaattatca
acgttgtgtgacggtggggaactcagagaccacatcttactgcccacctccatatgcccc
atcacccgggacaggccaggtgagaagtctgatggctgcgtgtccgccaagggcgaactt
gtcatgcagtataagatcatccccaccccgggtacccaccccctgctggtcttggtgaac
cccaagagtggagggagacaaggagaaaggttgaactttttccgtgatactccagacttc
cgtgttttggcctgtggtggagatgggacagttggctggattttggattgcattgataag
gccaactttgcaaagcatccaccagtggctgtcctgcctcttggaacaggaaatgacctt
gcccgttgtctccgctggggaggaggttatgaagggggcagcttgacaaaaatcctgaaa
gacattgagcagagccccttggtgatgctggaccgctggcatctggaagtcatccccaga
gaggaagtggaaaacggggaccaggtcccatacagcatcatgaacaactatttctccatt
ggtgtggacgcttccattgcacacagattccatgtgatgagagagaaacatcctgaaaaa
ttcaacagcaggatgaagaacaagctgtggtactttgaatttggcacctcggagactttt
gcagcgacctgcaagaaactccacgaccacattgagttggagtgtgatggggttggggtg
gacctgagcaacatcttcctggaaggcattgccattctcaacattcccagcatgtacgga
ggcaccaatctctggggagaaaacaagaagaaccgggctgtgatccgggaaagcaggaag
ggtgtcactgaccccaaagaactgaaattctgcgttcaagacctcagtgaccagctcctt
gaagtggtggggctagaaggagccatggagatggggcagatctacaccggcctgaagagt
gcaggcaggaggctggcccagtgcgcctctgtcaccatcaggacaaacaagctgctgcca
atgcaagtggatggagaaccctggatgcagccatgttgcacgattaaaattactcacaag
aaccaagcgcccatgatgatggggcctccccagaagagcagcttcttctcgttgagaagg
aagagccgttcaaaagactaa

DBGET integrated database retrieval system