KEGG   Homo sapiens (human): 1608Help
Entry
1608              CDS       T01001                                 

Gene name
DGKG, DAGK3, DGK-GAMMA
Definition
diacylglycerol kinase, gamma 90kDa (EC:2.7.1.107)
Orthology
K00901  
diacylglycerol kinase (ATP dependent) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q27.2-q27.3
AA seq 766 aa AA seqDB search
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMR
AYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEAC
APDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKL
EFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFV
SLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHIMLMGVRKQGL
CCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQS
VTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERLNFFRDTPDFRVLACGGDGTVGWILDCIDK
ANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSLTKILKDIEQSPLVMLDRWHLEVIPR
EEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETF
AATCKKLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKKNRAVIRESRK
GVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCASVTIRTNKLLP
MQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaacggtgggtctccctcactccagaagaatttgaccaactccagaaatat
tcagaatattcctccaagaagataaaagatgccttgactgaatttaatgagggtgggagc
ctcaaacaatatgacccacatgagccgattagctatgatgtcttcaagctgttcatgagg
gcgtacctggaggtggaccttccccagccactgagcactcacctcttcctggccttcagc
cagaagcccagacacgagacctctgaccacccgacggagggagccagcaacagtgaggcc
aacagcgcagatactaatatacagaatgcagataatgccaccaaagcagacgaggcctgt
gcccctgatactgaatcaaatatggctgagaagcaagcaccagctgaagaccaagtggct
gcgacccccctggaaccccccgtccctcggtcttcaagctcggaatccccagtggtatac
ctgaaggatgttgtgtgctacctgtccctgctggagacggggaggcctcaggataagctg
gagttcatgtttcgcctctatgattcagatgagaacggtctcctggaccaagcggagatg
gattgcattgtcaaccaaatgctgcatattgcccagtacctggagtgggatcccacagag
ctgaggcctatattgaaggagatgctgcaagggatggactacgaccgggacggctttgtg
tctctacaggaatgggtccatggagggatgaccaccatcccattgctggtcctcctgggg
atggatgactctggctccaagggggatgggcggcacgcctggaccatgaagcacttcaag
aaaccaacctactgcaacttctgccatatcatgctcatgggcgtccgcaagcaaggcctg
tgctgcacttactgtaaatacactgtccacgaacgctgtgtgtccagaaacattcctggt
tgtgtcaaaacgtactcaaaagccaaaaggagtggtgaggtgatgcagcacgcatgggtg
gaagggaactcctccgtcaagtgtgaccggtgccacaaaagtatcaagtgctaccagagt
gtcaccgcgcggcactgcgtgtggtgccggatgacgtttcaccgcaaatgtgaattatca
acgttgtgtgacggtggggaactcagagaccacatcttactgcccacctccatatgcccc
atcacccgggacaggccaggtgagaagtctgatggctgcgtgtccgccaagggcgaactt
gtcatgcagtataagatcatccccaccccgggtacccaccccctgctggtcttggtgaac
cccaagagtggagggagacaaggagaaaggttgaactttttccgtgatactccagacttc
cgtgttttggcctgtggtggagatgggacagttggctggattttggattgcattgataag
gccaactttgcaaagcatccaccagtggctgtcctgcctcttggaacaggaaatgacctt
gcccgttgtctccgctggggaggaggttatgaagggggcagcttgacaaaaatcctgaaa
gacattgagcagagccccttggtgatgctggaccgctggcatctggaagtcatccccaga
gaggaagtggaaaacggggaccaggtcccatacagcatcatgaacaactatttctccatt
ggtgtggacgcttccattgcacacagattccatgtgatgagagagaaacatcctgaaaaa
ttcaacagcaggatgaagaacaagctgtggtactttgaatttggcacctcggagactttt
gcagcgacctgcaagaaactccacgaccacattgagttggagtgtgatggggttggggtg
gacctgagcaacatcttcctggaaggcattgccattctcaacattcccagcatgtacgga
ggcaccaatctctggggagaaaacaagaagaaccgggctgtgatccgggaaagcaggaag
ggtgtcactgaccccaaagaactgaaattctgcgttcaagacctcagtgaccagctcctt
gaagtggtggggctagaaggagccatggagatggggcagatctacaccggcctgaagagt
gcaggcaggaggctggcccagtgcgcctctgtcaccatcaggacaaacaagctgctgcca
atgcaagtggatggagaaccctggatgcagccatgttgcacgattaaaattactcacaag
aaccaagcgcccatgatgatggggcctccccagaagagcagcttcttctcgttgagaagg
aagagccgttcaaaagactaa

DBGET integrated database retrieval system