KEGG   Homo sapiens (human): 1612Help
Entry
1612              CDS       T01001                                 

Gene name
DAPK1, DAPK
Definition
death-associated protein kinase 1 (EC:2.7.11.1)
Orthology
K08803  
death-associated protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Bladder cancer
Disease
H00022  
Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1612 (DAPK1)
   05219 Bladder cancer
    1612 (DAPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1612 (DAPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  DAPK family
   1612 (DAPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q21.33
AA seq 1430 aa AA seqDB search
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA
RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
THHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR
NT seq 4293 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgttcaggcaggaaaacgtggatgattactacgacaccggcgaggaacttggc
agtggacagtttgcggttgtgaagaaatgccgtgagaaaagcaccggcctccagtatgcc
gccaaattcatcaagaaaaggaggactaagtccagccggcggggtgtgagccgcgaggac
atcgagcgggaggtcagcatcctgaaggagatccagcaccccaatgtcatcaccctgcac
gaggtctatgagaacaagacggacgtcatcctgatcttggaactcgttgcaggtggcgag
ctgtttgacttcttagctgaaaaggaatctttaactgaagaggaagcaactgaatttctc
aaacaaattcttaatggtgtttactacctgcactcccttcaaatcgcccactttgatctt
aagcctgagaacataatgcttttggatagaaatgtccccaaacctcggatcaagatcatt
gactttgggttggcccataaaattgactttggaaatgaatttaaaaacatatttgggact
ccagagtttgtcgctcctgagatagtcaactatgaacctcttggtcttgaggcagatatg
tggagtatcggggtaataacctatatcctcctaagtggggcctccccatttcttggagac
actaagcaagaaacgttagcaaatgtatccgctgtcaactacgaatttgaggatgaatac
ttcagtaataccagtgccctagccaaagatttcataagaagacttctggtcaaggatcca
aagaagagaatgacaattcaagatagtttgcagcatccctggatcaagcctaaagataca
caacaggcacttagtagaaaagcatcagcagtaaacatggagaaattcaagaagtttgca
gcccggaaaaaatggaaacaatccgttcgcttgatatcactgtgccaaagattatccagg
tcattcctgtccagaagtaacatgagtgttgccagaagcgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcatccatgccatcaacgatgacaatgtcccaggcctg
cagcaccttctgggctcattatccaactatgatgttaaccaacccaacaagcacgggaca
cctccattactcattgctgctggctgtgggaatattcaaatactacagttgctcattaaa
agaggctcgagaatcgatgtccaggataagggcgggtccaatgccgtctactgggctgct
cggcatggccacgtcgataccttgaaatttctcagtgagaacaaatgccctttggatgtg
aaagacaagtctggagagatggccctccacgtggcagctcgctatggccatgctgacgtg
gctcagttactgtgcagcttcggctcaaatcccaatatccaggacaaggaagaagaaacc
cccctgcactgtgctgcttggcacggctattactctgtggccaaagccctttgtgaagcc
ggctgtaacgtgaacatcaagaaccgagaaggagagacgcccctcctgacagcctctgcc
aggggctaccacgacatcgtggagtgtctggccgaacatggagccgaccttaatgcttgc
gacaaggacggacacattgcccttcatctggctgtaagacggtgtcagatggaggtaatc
aagactctcctcagccaagggtgtttcgtcgattatcaagacaggcacggcaatactccc
ctccatgtggcatgtaaagatggcaacatgcctatcgtggtggccctctgtgaagcaaac
tgcaatttggacatctccaacaagtatgggcgaacgcctctgcaccttgcggccaacaac
ggaatcctagacgtggtccggtatctctgtctgatgggagccagcgttgaggcgctgacc
acggacggaaagacggcagaagatcttgctagatcggaacagcacgagcacgtagcaggt
ctccttgcaagacttcgaaaggatacgcaccgaggactcttcatccagcagctccgaccc
acacagaacctgcagccaagaattaagctcaagctgtttggccactcgggatccgggaaa
accacccttgtagaatctctcaagtgtgggctgctgaggagctttttcagaaggcgtcgg
cccagactgtcttccaccaactccagcaggttcccaccttcacccctggcttctaagccc
acagtctcagtgagcatcaacaacctgtacccaggctgcgagaacgtgagtgtgaggagc
cgcagcatgatgttcgagccgggtcttaccaaagggatgctggaggtgtttgtggccccg
acccaccacccgcactgctcggccgatgaccagtccaccaaggccatcgacatccagaac
gcttatttgaatggagttggcgatttcagcgtgtgggagttctctggaaatcctgtgtat
ttctgctgttatgactattttgctgcaaatgatcccacgtcaatccatgttgttgtcttt
agtctagaagagccctatgagatccagctgaaccaagtgattttctggctcagtttcctg
aagtcccttgtcccagttgaagaacccatagccttcggtggcaagctgaagaacccactc
caagttgtcctggtggccacccacgctgacatcatgaatgttcctcgaccggctggaggc
gagtttggatatgacaaagacacatcgttgctgaaagagattaggaacaggtttggaaat
gatcttcacatttcaaataagctgtttgttctggatgctggggcttctgggtcaaaggac
atgaaggtacttcgaaatcatctgcaagaaatacgaagccagattgtttcggtctgtcct
cccatgactcacctgtgtgagaaaatcatctccacgctgccttcctggaggaagctcaat
ggacccaaccagctgatgtcgctgcagcagtttgtgtacgacgtgcaggaccagctgaac
cccctggccagcgaggaggacctcaggcgcattgctcagcagctccacagcacaggcgag
atcaacatcatgcaaagtgaaacagttcaggacgtgctgctcctggacccccgctggctc
tgcacaaacgtcctggggaagttgctgtccgtggagaccccacgggcgctgcaccactac
cggggccgctacaccgtggaggacatccagcgcctggtgcccgacagcgacgtggaggag
ctgctgcagatcctcgatgccatggacatctgcgcccgggacctgagcagcgggaccatg
gtggacgtcccagccctgatcaagacagacaacctgcaccgctcctgggctgatgaggag
gacgaggtgatggtgtatggtggcgtgcgcatcgtgcccgtggaacacctcacccccttc
ccatgtggcatctttcacaaggtccaggtgaacctgtgccggtggatccaccagcaaagc
acagagggcgacgcggacatccgcctgtgggtgaatggctgcaagctggccaaccgtggg
gccgagctgctggtgctgctggtcaaccacggccagggcattgaggtccaggtccgcggc
ctggagacggagaagatcaagtgctgcctgctgctggactcggtgtgcagcaccattgag
aacgtcatggccaccacgctgccagggctcctgaccgtgaagcattacctgagcccccag
cagctgcgggagcaccatgagcccgtcatgatctaccagccacgggacttcttccgggca
cagactctgaaggaaacctcactgaccaacaccatgggggggtacaaggaaagcttcagc
agcatcatgtgcttcgggtgtcacgacgtctactcacaggccagcctcggcatggacatc
catgcatcagacctgaacctcctcactcggaggaaactgagtcgcctgctggacccgccc
gaccccctggggaaggactggtgccttctcgccatgaacttaggcctccctgacctcgtg
gcaaagtacaacaccagtaacggggctcccaaggatttcctccccagccccctccacgcc
ctgctgcgggaatggaccacctaccctgagagcacagtgggcaccctcatgtccaaactg
agggagctgggtcgccgggatgccgcagactttttgctgaaggcatcctctgtgttcaaa
atcaacctggatggcaatggccaggaggcctatgcctcgagctgcaacagcggcacctct
tacaattccattagctctgttgtatcccggtga

DBGET integrated database retrieval system