KEGG   Homo sapiens (human): 1613Help
Entry
1613              CDS       T01001                                 

Gene name
DAPK3, DLK, ZIP, ZIPK
Definition
death-associated protein kinase 3 (EC:2.7.11.1)
Orthology
K08803  
death-associated protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1613 (DAPK3)
   05219 Bladder cancer
    1613 (DAPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1613 (DAPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  DAPK family
   1613 (DAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 454 aa AA seqDB search
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgttcaggcaggaggacgtggaggaccattatgagatgggggaggagctgggc
agcggccagtttgcgatcgtgcggaagtgccggcagaagggcacgggcaaggagtacgca
gccaagttcatcaagaagcgccgcctgtcatccagccggcgtggggtgagccgggaggag
atcgagcgggaggtgaacatcctgcgggagatccggcaccccaacatcatcaccctgcac
gacatcttcgagaacaagacggacgtggtcctcatcctggagctggtctctggcggggag
ctctttgacttcctggcggagaaggagtcgctgacggaggacgaggccacccagttcctc
aagcagatcctggacggcgttcactacctgcactctaagcgcatcgcacactttgacctg
aagccggaaaacatcatgctgctggacaagaacgtgcccaacccacgaatcaagctcatc
gacttcggcatcgcgcacaagatcgaggcggggaacgagttcaagaacatcttcggcacc
ccggagtttgtggccccagagattgtgaactatgagccgctgggcctggaggcggacatg
tggagcatcggtgtcatcacctatatcctcctgagcggtgcatccccgttcctgggcgag
accaagcaggagacgctcaccaacatctcagccgtgaactacgacttcgacgaggagtac
ttcagcaacaccagcgagctggccaaggacttcattcgccggctgctcgtcaaagatccc
aagcggagaatgaccattgcccagagcctggaacattcctggattaaggcgatccggcgg
cggaacgtgcgtggtgaggacagcggccgcaagcccgagcggcggcgcctgaagaccacg
cgtctgaaggagtacaccatcaagtcgcactccagcttgccgcccaacaacagctacgcc
gacttcgagcgcttctccaaggtgctggaggaggcggcggccgccgaggagggcctgcgc
gagctgcagcgcagccggcggctctgccacgaggacgtggaggcgctggccgccatctac
gaggagaaggaggcctggtaccgcgaggagagcgacagcctgggccaggacctgcggagg
ctacggcaggagctgctcaagaccgaggcgctcaagcggcaggcgcaggaggaggccaag
ggcgcgctgctggggaccagcggcctcaagcgccgcttcagccgcctggagaaccgctac
gaggcgctggccaagcaagtagcctccgagatgcgcttcgtgcaggacctcgtgcgcgcc
ctggagcaggagaagctgcagggcgtggagtgcgggctgcgctag

DBGET integrated database retrieval system