KEGG   Homo sapiens (human): 1613Help
Entry
1613              CDS       T01001                                 

Gene name
DAPK3, ZIP, ZIPK
Definition
death-associated protein kinase 3 (EC:2.7.11.1)
Orthology
K08803  
death-associated protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Bladder cancer
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 454 aa AA seqDB search
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgttcaggcaggaggacgtggaggaccattatgagatgggggaggagctgggc
agcggccagtttgcgatcgtgcggaagtgccggcagaagggcacgggcaaggagtacgca
gccaagttcatcaagaagcgccgcctgtcatccagccggcgtggggtgagccgggaggag
atcgagcgggaggtgaacatcctgcgggagatccggcaccccaacatcatcaccctgcac
gacatcttcgagaacaagacggacgtggtcctcatcctggagctggtctctggcggggag
ctctttgacttcctggcggagaaagagtcgctgacggaggacgaggccacccagttcctc
aagcagatcctggacggcgttcactacctgcactctaagcgcatcgcacactttgacctg
aagccggaaaacatcatgctgctggacaagaacgtgcccaacccacgaatcaagctcatc
gacttcggcatcgcgcacaagatcgaggcggggaacgagttcaagaacatcttcggcacc
ccggagtttgtggccccagagattgtgaactatgagccgctgggcctggaggcggacatg
tggagcatcggtgtcatcacctatatcctcctgagcggtgcatccccgttcctgggcgag
accaagcaggagacgctcaccaacatctcagccgtgaactacgacttcgacgaggagtac
ttcagcaacaccagcgagctggccaaggacttcattcgccggctgctcgtcaaagatccc
aagcggagaatgaccattgcccagagcctggaacattcctggattaaggcgatccggcgg
cggaacgtgcgtggtgaggacagcggccgcaagcccgagcggcggcgcctgaagaccacg
cgtctgaaggagtacaccatcaagtcgcactccagcttgccgcccaacaacagctacgcc
gacttcgagcgcttctccaaggtgctggaggaggcggcggccgccgaggagggcctgcgc
gagctgcagcgcagccggcggctctgccacgaggacgtggaggcgctggccgccatctac
gaggagaaggaggcctggtaccgcgaggagagcgacagcctgggccaggacctgcggagg
ctacggcaggagctgctcaagaccgaggcgctcaagcggcaggcgcaggaggaggccaag
ggcgcgctgctggggaccagcggcctcaagcgccgcttcagccgcctggagaaccgctac
gaggcgctggccaagcaagtagcctccgagatgcgcttcgtgcaggacctcgtgcgcgcc
ctggagcaggagaagctgcagggcgtggagtgcgggctgcgctag

DBGET integrated database retrieval system