KEGG   Homo sapiens (human): 161931Help
Entry
161931            CDS       T01001                                 

Gene name
ADAD2, TENRL
Definition
(RefSeq) adenosine deaminase domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.1
AA seq 583 aa AA seqDB search
MASASQGADDDGSRRKPRLAASLQISPQPRPWRPLPAQAQSAWGPAPAPATYRAEGGWPQ
VSVLRDSGPGAGAGVGELGAARAWENLGEQMGKAPRVPVPPAGLSLPLKDPPASQAVSLL
TEYAASLGIFLLFREDQPPGPCFPFSVSAELDGVVCPAGTANSKTEAKQQAALSALCYIR
SQLENPESPQTSSRPPLAPLSVENILTHEQRCAALVSAGFDLLLDERSPYWACKGTVAGV
ILEREIPRARGHVKEIYKLVALGTGSSCCAGWLEFSGQQLHDCHGLVIARRALLRFLFRQ
LLLATQGGPKGKEQSVLAPQPGPGPPFTLKPRVFLHLYISNTPKGAARDIYLPPTSEGGL
PHSPPMRLQAHVLGQLKPVCYVAPSLCDTHVGCLSASDKLARWAVLGLGGALLAHLVSPL
YSTSLILADSCHDPPTLSRAIHTRPCLDSVLGPCLPPPYVRTALHLFAGPPVAPSEPTPD
TCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAFHQAARAVGKPYLL
ALKTYEAAKAGPYQEARRQLSLLLDQQGLGAWPSKPLVGKFRN
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggcttctcagggcgctgacgacgacggcagtcgtaggaagccccgcctggct
gcatcgttgcagatcagcccccagccccgcccctggcgaccgctacccgcccaggcccaa
agtgcctgggggcccgcgcccgcgcccgcgacgtatcgcgcggagggcgggtggccccag
gtctcggtgttgagggacagtgggcctggggcaggggccggagtcggggaactgggggca
gcccgggcgtgggaaaacttgggggaacagatggggaaggccccgagggtccctgtgccc
ccagcagggctcagcctgccgctcaaagacccacctgccagccaggccgtgtccttgctc
acggagtacgcggccagcctgggcatcttcctgctcttccgggaggaccagccaccaggt
ccctgcttccccttctcggtgagcgcggaactggatggggtggtctgccctgcgggcact
gcgaatagcaagacggaggccaaacagcaggcagcgctctctgccctctgctacatccgg
agtcagctggagaacccagagtccccccagacctccagccggcctccactggcccccctg
agcgtagagaacatcctgacccatgagcagcgctgcgcagcgttggtgagcgccggcttt
gacctcctgttggacgagcgctcgccatactgggcctgtaaggggactgtggctggagtc
atcctggagagggagatcccgcgtgccaggggccacgtgaaggagatctacaagctggtg
gctctgggcaccggcagcagctgctgtgctggctggctggagttctcgggccagcagctc
cacgactgccatggcctggtcatcgcccgcagggccctgctgaggttcttgttccggcag
ctcctgctggccacacaggggggccccaagggcaaggagcagtccgtgctggccccccag
ccagggcccggacccccattcaccctcaagccccgcgtcttcctgcacctctacatcagc
aacacccccaagggcgcggcccgtgacatctacctgccccccacctcggaaggtggcctc
ccgcacagcccacccatgcgcctgcaggcccatgtgctcgggcagctgaagcctgtgtgc
tacgtggcgccctcgctctgtgacacccacgtgggctgcctgtcagccagtgacaagctg
gcacgctgggccgtgctggggctgggtggtgccctgctggcccacctggtgtccccactc
tacagcaccagcctcatcctggctgactcatgccacgaccctccgactctgagcagggcc
atccacacccggccctgcctggacagtgtcctggggccatgcctgccacctccctacgtc
cggaccgccctgcacctgtttgcagggcccccggtggccccttccgaacccacccctgac
acctgccgtggcctgagcctcaactggagcctgggggaccctggcatcgaggttgtggat
gtggccaccgggcgtgtgaaggccaatgccgccctggggcctccctcccgtctctgcaag
gcctcctttctccgggcctttcaccaggcggccagggctgtggggaagccctacctcctg
gccttgaagacctacgaggctgccaaggctgggccctaccaggaggctcgcaggcagctg
tctctcctcctggaccagcagggcctgggggcttggccctcgaagccactggtgggcaaa
ttcagaaactga

DBGET integrated database retrieval system