KEGG   Homo sapiens (human): 162Help
Entry
162               CDS       T01001                                 

Gene name
AP1B1, ADTB1, AP105A, BAM22, CLAPB2
Definition
(RefSeq) adaptor related protein complex 1 beta 1 subunit
  KO
K12392  
AP-1 complex subunit beta-1
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    162 (AP1B1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    162 (AP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q10567(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.2
AA seq 949 aa AA seqDB search
MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANA
VAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQY
VALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRK
YPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEV
VLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASS
ESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLG
GGLDSLMGDEPEGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPK
AVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQ
VHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGK
MDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSL
KLTNGIWVLAELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAYETILKN
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgactgactcaaaatatttcaccacgaccaagaaaggggagatcttcgagctgaaggca
gagctcaacagtgacaagaaggagaagaagaaggaggcagtgaagaaagtgattgcatcg
atgaccgtgggcaaagatgtcagtgccctcttccccgatgtggtcaactgcatgcagacg
gacaacctggagctgaagaagctagtatacctctacttgatgaattacgccaagagtcag
cctgacatggccattatggccgtcaacacctttgtgaaggactgtgaggaccccaacccc
ctcatccgagccctggcagtgcggaccatgggctgcatccgcgttgacaagatcacagag
tacctgtgcgagccactccggaagtgcctgaaggacgaggatccatatgtgcgcaagaca
gcagctgtgtgcgtggccaagctccacgacatcaacgcccagctggtggaggaccagggc
ttcctggacacccttaaagacctcatctccgactctaaccccatggtggtggccaatgca
gtggcagcgctctcagaaattgccgagtctcaccccagcagcaacctgctcgatctgaac
ccacagtccatcaacaagctgctgacagccctcaatgagtgcaccgagtggggccagatc
ttcatcctggactgcctcgccaactatatgcccaaggacgaccgcgaggcccagagcatc
tgtgagcgggtcacccccaggctctcccatgccaactccgctgtggtgctctctgctgtg
aaggtgctgatgaagttcatggagatgttgtctaaggacttggactactacggcacactg
ctcaagaagctggccccacccctggtcacactgctgtcagccgagccagagctgcagtat
gtggccctgcgcaacatcaatctcatcgtgcagaaaaggcctgagatcctgaagcatgag
atgaaggtgttcttcgtgaagtacaacgaccctatctacgtgaagctggagaagctggac
atcatgatccgcctggcctctcaggccaacatcgcccaggtgttggcagagctgaaagag
tacgcaacagaagtggatgtggactttgtacggaaggctgtgcgtgctattggccgctgc
gccatcaaggtggagcaatctgcggagcgctgtgtgagcacgctgctcgacctcatccag
accaaggtcaactatgtggtccaggaggccatcgtggtcatcaaggacatcttccgcaag
taccccaacaagtatgagagtgtgattgccacactgtgtgagaatctggactccctggat
gagcctgaggcccgggctgccatgatctggattgtgggcgagtacgcggaacggatcgac
aacgcagatgagctgctggagagcttcctcgagggcttccatgacgagagcacacaggtc
cagctgcagctgctgacagccattgtgaaactctttctaaagaagccaacagagacccag
gagctggtgcagcaggtcctcagtttggccactcaggactcagataacccagacctgcgg
gaccgtggctacatctactggcgcctgctgtccacggacccggtggcagccaaggaggtg
gtgttggctgagaagccactcatctctgaagagacggacctcatcgagcccacactgtta
gacgagcttatctgctacatcggcacgctggcttccgtctaccataagcctcccagtgcc
tttgtggaggggggccggggcgtcgtgcacaagagcctgccacctcgcacggcctcgagt
gagagcgcagagagccctgagacagcccctactggagcacctcctggggagcagccagat
gtcatccccgcccagggcgacctgctgggtgacctcctcaacctggacctcggcccccca
gtgagcggcccacccctggccacctcctcggtgcagatgggagctgtggaccttcttggc
ggtggccttgacagcctgatgggggatgagcctgaagggattgggggcaccaacttcgtg
gcacctccaacagcagcagtaccagccaatcttggagcacccatcggcagtggcctgagt
gacctctttgacctgaccagtggcgtgggcaccctgtcaggatcatatgtggcccccaaa
gcagtctggctcccagccatgaaggctaaggggctggagatctcaggcaccttcacccgc
caggtgggctccatctccatggacctgcagctgaccaacaaggccttgcaggtcatgacc
gactttgccatccagttcaaccgcaacagctttggcctggcccccgccgcccccctccag
gtccacgcgccactcagccccaaccagacagtggagatctccctgcctctcagcacggtg
ggctcggtcatgaagatggagcctctgaacaacctccaggtggccgtgaagaacaacatc
gatgtcttctacttcagcaccttgtacccactgcacatcctctttgtggaggacgggaag
atggaccggcagatgttcctggccacatggaaggatattcccaatgagaatgaggcccag
ttccagatcagagactgccccctcaatgcagaggctgcgagcagcaagctgcagagcagc
aacatcttcactgtcgccaagaggaacgtggagggccaggacatgctctaccagtccctg
aagctgaccaacggcatctgggtgctggcggagctgcggatccagccgggcaaccccagc
tgcacggacttagagctgtccctgaagtgtcgagcaccagaggtgtcccagcacgtgtac
caggcctacgagaccatcctcaagaactga

DBGET integrated database retrieval system