KEGG   Homo sapiens (human): 1622Help
Entry
1622              CDS       T01001                                 

Gene name
DBI, ACBD1, ACBP, CCK-RP, EP
Definition
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) (EC:3.4.17.3)
Orthology
K08762  
diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Class
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q12-q21
AA seq 87 aa AA seqDB search
MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWN
ELKGTSKEDAMKAYINKVEELKKKYGI
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggctgagtttgagaaagctgcagaggaggttaggcaccttaagaccaagcca
tcggatgaggagatgctgttcatctatggccactacaaacaagcaactgtgggcgacata
aatacagaacggcccgggatgttggacttcacgggcaaggccaagtgggatgcctggaat
gagctgaaagggacttccaaggaagatgccatgaaagcttacatcaacaaagtagaagag
ctaaagaaaaaatacgggatatga

DBGET integrated database retrieval system