KEGG   Homo sapiens (human): 162514Help
Entry
162514            CDS       T01001                                 

Gene name
TRPV3, FNEPPK2, OLMS, VRL3
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 3
  KO
K04972  
transient receptor potential cation channel subfamily V member 3
Organism
hsa  Homo sapiens (human)
Pathway
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    162514 (TRPV3)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   162514 (TRPV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.2
AA seq 790 aa AA seqDB search
MKAHPKEMVPLMGKRVAAPSGNPAILPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTS
PPVFSKPMDSNIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLK
KRIFAAVSEGCVEELVELLVELQELCRRRHDEDVPDFLMHKLTASDTGKTCLMKALLNIN
PNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTALNIAIERRQGDIAALLIAAGAD
VNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYI
LSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMG
WLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLG
FGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFE
EVEEFPETSV
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccaccccaaggagatggtgcctctcatgggcaagagagttgctgcccccagt
gggaaccctgccatcctgccagagaagaggccggcggagatcacccccacaaagaagagt
gcacacttcttcctggagatagaagggtttgaacccaaccccacagttgccaagacctct
cctcctgtcttctccaagcccatggattccaacatccggcagtgcatctctggtaactgt
gatgacatggactccccccagtctcctcaggatgatgtgacagagaccccatccaatccc
aacagccccagtgcacagctggccaaggaagagcagaggaggaaaaagaggcggctgaag
aagcgcatctttgcagccgtgtctgagggctgcgtggaggagttggtagagttgctggtg
gagctgcaggagctttgcaggcggcgccatgatgaggatgtgcctgacttcctcatgcac
aagctgacggcctccgacacggggaagacctgcctgatgaaggccttgttaaacatcaac
cccaacaccaaggagatagtgcggatcctgcttgcctttgctgaagagaacgacatcctg
ggcaggttcatcaacgccgagtacacagaggaggcctatgaagggcagacggcgctgaac
atcgccatcgagcggcggcagggggacatcgcagccctgctcatcgccgccggcgccgac
gtcaacgcgcacgccaagggggccttcttcaaccccaagtaccaacacgaaggcttctac
ttcggtgagacgcccctggccctggcagcatgcaccaaccagcccgagattgtgcagctg
ctgatggagcacgagcagacggacatcacctcgcgggactcacgaggcaacaacatcctt
cacgccctggtgaccgtggccgaggacttcaagacgcagaatgactttgtgaagcgcatg
tacgacatgatcctactgcggagtggcaactgggagctggagaccactcgcaacaacgat
ggcctcacgccgctgcagctggccgccaagatgggcaaggcggagatcctgaagtacatc
ctcagtcgtgagatcaaggagaagcggctccggagcctgtccaggaagttcaccgactgg
gcgtacggacccgtgtcatcctccctctacgacctcaccaacgtggacaccaccacggac
aactcagtgctggaaatcactgtctacaacaccaacatcgacaaccggcatgagatgctg
accctggagccgctgcacacgctgctgcatatgaagtggaagaagtttgccaagcacatg
ttctttctgtccttctgcttttatttcttctacaacatcaccctgaccctcgtctcgtac
taccgcccccgggaggaggaggccatcccgcaccccttggccctgacgcacaagatgggg
tggctgcagctcctagggaggatgtttgtgctcatctgggccatgtgcatctctgtgaaa
gagggcattgccatcttcctgctgagaccctcggatctgcagtccatcctctcggatgcc
tggttccactttgtcttttttatccaagctgtgcttgtgatactgtctgtcttcttgtac
ttgtttgcctacaaagagtacctcgcctgcctcgtgctggccatggccctgggctgggcg
aacatgctctactatacgcggggtttccagtccatgggcatgtacagcgtcatgatccag
aaggtcattttgcatgatgttctgaagttcttgtttgtatatatcgtgtttttgcttgga
tttggagtagccttggcctcgctgatcgagaagtgtcccaaagacaacaaggactgcagc
tcctacggcagcttcagcgacgcagtgctggaactcttcaagctcaccataggcctgggt
gacctgaacatccagcagaactccaagtatcccattctctttctgttcctgctcatcacc
tatgtcatcctcacctttgttctcctcctcaacatgctcattgctctgatgggcgagact
gtggagaacgtctccaaggagagcgaacgcatctggcgcctgcagagagccaggaccatc
ttggagtttgagaaaatgttaccagaatggctgaggagcagattccggatgggagagctg
tgcaaagtggccgaggatgatttccgactgtgtttgcggatcaatgaggtgaagtggact
gaatggaagacgcacgtctccttccttaacgaagacccggggcctgtaagacgaacagat
ttcaacaaaatccaagattcttccaggaacaacagcaaaaccactctcaatgcatttgaa
gaagtcgaggaattcccggaaacctcggtgtag

DBGET integrated database retrieval system